SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002434 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002434
Domain Number 1 Region: 4-195
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.22e-83
Family Inorganic pyrophosphatase 0.000000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002434   Gene: ENSVPAG00000002632   Transcript: ENSVPAT00000002632
Sequence length 288
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_772:428144:451626:-1 gene:ENSVPAG00000002632 transcript:ENSVPAT00000002632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSFSSEERAAPFTLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEI
ATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPTWEDPGHNDKHTGCCGDNDPID
VCEIGSKVCARGEIIRVKILGILAMIDEGETDWKVIAINVEDPDAANYNDINDVKRLKPG
YLEATVDWFRRYKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XMNTTVSESPFQCDPDAAKAIVDSLPPPCESACTIPTDVDKWFHHQKN
Download sequence
Identical sequences ENSVPAP00000002434 ENSVPAP00000002434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]