SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002512 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002512
Domain Number 1 Region: 129-373
Classification Level Classification E-value
Superfamily vWA-like 1.98e-85
Family Integrin A (or I) domain 0.0000000467
Further Details:      
 
Domain Number 2 Region: 371-458
Classification Level Classification E-value
Superfamily Integrin domains 1.36e-23
Family Integrin domains 0.0003
Further Details:      
 
Domain Number 3 Region: 622-705
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.11e-17
Family Integrin beta tail domain 0.001
Further Details:      
 
Domain Number 4 Region: 21-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000889
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 580-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Integrin beta EGF-like domains 0.0018
Further Details:      
 
Domain Number 6 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Domain Number 7 Region: 80-154
Classification Level Classification E-value
Superfamily Integrin domains 0.00000575
Family Integrin domains 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000002512
Domain Number - Region: 506-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00977
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002512   Gene: ENSVPAG00000002715   Transcript: ENSVPAT00000002715
Sequence length 788
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1542:392852:467527:-1 gene:ENSVPAG00000002715 transcript:ENSVPAT00000002715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIELLCLLFLFLGRNDHVQGGCAVGGAETCEDCLLAGPQCAWCSQENFTHLSGVGERCD
TPANLLAKGCQITFIENPVSQVEILMNKPLSVGRQKNSSNIVQITPQSLALKLRPGSEQT
LQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSLLSKEMSKLTSNFRLGFGSFVEK
PISPFMKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGVLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNSTPVPHQKKCSHMKVGDTASFNVT
VSIPNCERRSRNIIIKPVGLGDALEILVSPECSCDCQKEVEVNSSRCNNGNGAFQCGVCV
CNPGHMGPHCECGEDTLSTDSCREAPEHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCD
NFSCVRHKGLLCGDNGDCDCGECVCRSGWTGEYCNCTTSTDPCISEDGALCSGRGDCVCG
RCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSVDGQTREECVDKCKLAGVTINEEE
DFSKDSSVSCSLQGENECLITFLITTDNEGKTIIHSINEKDCPKPPNIPMIMLGVSLAIL
LIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQ
KVDLSTDG
Download sequence
Identical sequences ENSVPAP00000002512 XP_015105163.1.17985 ENSVPAP00000002512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]