SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002535 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002535
Domain Number 1 Region: 409-536
Classification Level Classification E-value
Superfamily SIS domain 6.3e-42
Family Phosphoglucose isomerase, PGI 0.000000829
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily SIS domain 7.41e-23
Family Phosphoglucose isomerase, PGI 0.00000292
Further Details:      
 
Domain Number 3 Region: 294-342
Classification Level Classification E-value
Superfamily SIS domain 0.0000000000000381
Family Phosphoglucose isomerase, PGI 0.0000703
Further Details:      
 
Domain Number 4 Region: 203-241
Classification Level Classification E-value
Superfamily SIS domain 0.0000000445
Family Phosphoglucose isomerase, PGI 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002535   Gene: ENSVPAG00000002738   Transcript: ENSVPAT00000002738
Sequence length 541
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1218:164354:233778:1 gene:ENSVPAG00000002738 transcript:ENSVPAT00000002738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKKLQAWYHEHGSGLNLRRLFEGDKDRFNHFSLNLNTNHGHILVDYSKNLVTEAVMQMLV
DLXXXXXXXXXXXXXXXXXXXXXXXNRAVLHVALRNRSNTPILVDGKDVMPEVNRVLEKM
KSFCQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXTFTTQETITNAETAKEWFLMSAKDPSAVAKHFVALSTN
TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTTPLE
KNAPVLLALLGIWYINFFGCETQALLPYDQYMHRFAAYFQQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILLANFLAQT
EALMRGKSTEEARKELQAAGKSPEDIEKLLPHKVFELPTNSIVFLTPFILGTLIAMYEHK
IFVQGIIWDINSFDQWGVELGKQLAKKIEPELEGSSPVTSHDASTNGLINFIKQEREAKS
Q
Download sequence
Identical sequences ENSVPAP00000002535 ENSVPAP00000002535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]