SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002695 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002695
Domain Number 1 Region: 696-799
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 1.76e-27
Family Colipase-binding domain 0.084
Further Details:      
 
Domain Number 2 Region: 30-100
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000344
Family C-type lectin domain 0.022
Further Details:      
 
Domain Number 3 Region: 1402-1456,1494-1558
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000073
Family Voltage-gated potassium channels 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002695   Gene: ENSVPAG00000002916   Transcript: ENSVPAT00000002916
Sequence length 1646
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_621:1278168:1360199:-1 gene:ENSVPAG00000002916 transcript:ENSVPAT00000002916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFRGRTWLWLCIRTGIILGSELNRPEQHEKNHCYQLNMFHCTFEDAENYCSIQGGQLAF
TWNQEIQDLLLDFLKEGSKWWIGKNLVPLGKQRQGKNNTAAFSDQDTSYERNGNNSHSHW
RPKKTKREVTILRNKVTSVATHLSTTCHQPAGANLSKTLCHSISPFPAVPPRVTQQGVSA
MPVPSSQTPELTRPASVTHAEKALVEVTSSSKEDSHPDVFTPRPQESFQNTTDQAIDEIT
RNFSKVIRGLQAHDKLQQACEVLQNLAAFIPRFSESSQVSVMDSLVYLNEQLLKTSSSLD
SGMPVTVCLFXXALSNAVKAEASQRRSKHIEQVENILKMSLLSLGRIQEAFLPQNRCSES
AVTLTSSAATLMLSRQNISTLPRSSYTLGSPAPVRLGFPSVSALEELLNKHPGVSVQVTG
LAFNPFRDFDNKKIVGSIGSVLLSSNHKLLQVHDLMEDFEITLWRNESMETHPTNLNVST
DHFIIMVNVTSLEKSLIVHVAPESPLLMTLYLGFQYQPNHTCSHLNITLPKDKVSQKDEA
YTWVLTPESLRFGVGTYYVTAVVNKSKAGAQRTPTLFWVVTAATQCYFWDSHSDTWRSSG
CQVGPQSTLLRTQCLCNHLTYFGSEFFIVPRTVNIEDTVELFLRVTRNPVGVSLLASLLG
FYMFTFVWAWRKDQTDMQKVKVTVLADNDPSSQFHYLIEVSTGYRRRAATTAKVVITLYG
SEGRSKPHHLCDSQKAVFERGGLDVFLLGTPSSLGELHSLRLWHDNSGVSPSWYINQVIV
SDIAGKRKWHFLCNCWLAMDLGDCERDRVFSPVSKKELFSFXXXXXXXXXXKFTDLWLSV
ATRHPWNQTRVQRLTCCVTLFLCNMVINIMFWKINDTTAKRDVQVGPLAVTWSELLISVQ
SAVILFPINVVIGQLFPLIQSQEPLPFFPPIQASCPSGASFEPLPLTEVAEELKETVGFL
LRRNTYLLSECEQSSWSSYNINQLVKLFSSLICSHLEGQGSHQQAGPYWENAVPENHHHF
CNYLLRVLQKLQSHLRTLGPTQADQPCDFLDAVTQLQKLQELLETHTLPTERGPCREANS
FPILNPEEGKQSISNSPPRWLTYLCWLLLGTTSLAAAFFTVLYSLKLNKDQATSWVISLI
LSVLQNIFIIQPVKVIFLTLFFSLMLNRMPWLRKEKGQQRILALLAKCPSSLPGSRDKNN
PIYVAPAMNRPVKCPERALKEKKLLKLTGDILVQILFLILLMTTVYSTQSSNRFYLHQAI
QKSFSHGFSEIKLLKHFYTWANRILLPNLYGDYRGKNTVLGSSCKCGVQLVFQTPTGTHT
LEEGPLFHCGHPCGPKGPLPGPRLSKSSYVPPRVMGLIPTDEPHKRLINKTENLFTYSME
SAFFTSVKLDVLTSLQTSKDFAWSIISQVIYYLLVCYYVFIQGRQLKQQRWRFFTRKRNI
LDMSIILISFVILGLDMKFISLHKENMAQYHCDPDRFINFYEAVKVNSAVIHLMGFLVLL
ATVQLWNLLRQNLRLQVIGRTLSKAWDEVLGFLLVILILLSGYAIAFNLLFGWSISDYRT
LFSSAVTVVGLLMGISHYKEINLFVSAILMSFGKERKSLKKEAALTDMLLQKLSSLLGIQ
RPQNTCKQIAVTAIGIDNEVLKDGLS
Download sequence
Identical sequences ENSVPAP00000002695 ENSVPAP00000002695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]