SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002745 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002745
Domain Number 1 Region: 278-465
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.27e-43
Family cAMP-binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 28-91,135-269
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-18
Family Voltage-gated potassium channels 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002745   Gene: ENSVPAG00000002969   Transcript: ENSVPAT00000002969
Sequence length 575
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3064:74228:87880:1 gene:ENSVPAG00000002969 transcript:ENSVPAT00000002969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQDSKVKTTESSPPTPSKARKSLPVLDPSGDCYYWWLNTMVFPVMYNLIIVVCRACFPD
LQHGYLVAWLVLDYTSDLLYLLDIVVHFHTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXNRFLRAPRLFEAFDRTETRTAYPNAFRIAKLMLYIFVVI
HWNSCLYFALSRYLGLGRDVWVYPDPARPGFERLLRQYLYSFYFSTLILTTVGDTPPPAR
EEECLFMVGDFLLAVMGFATIMGSMSSVIYNMNTADAAFYPDHALVKKYMKLHHVNRRLE
RRVIDWYQHLQINKKMANEVAILQHLPERLRAEVAVSVHLSTLRRVQIFQNCEASLLEEL
VLKLQPQTYSPGEYVCRKGDVGREMYIIREGQLAVVADDGVTQYAVLGAGLYFGEISIIN
IKGNMSGIRRTANIKSLCYSDLFCLSKEDLREVLSEYPQAQAVMEEKGREILLKLNKLDV
NAEAAEIALQEATEARLRGLDQQLDDLQTKFARLLAELESSALKIAYRIERLEWQTREWP
VPEELAEADDEGEPGEGTSKDGEGTAGWEGFPGPE
Download sequence
Identical sequences ENSVPAP00000002745 ENSVPAP00000002745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]