SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002785 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002785
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-36
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000162
Further Details:      
 
Domain Number 2 Region: 168-264
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 6.28e-34
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000627
Further Details:      
 
Domain Number 3 Region: 341-452
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 6.8e-24
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002785   Gene: ENSVPAG00000003012   Transcript: ENSVPAT00000003012
Sequence length 464
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_275:2342061:2384313:-1 gene:ENSVPAG00000003012 transcript:ENSVPAT00000003012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFV
YNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPM
ATVDIKNPEITTNRFYGSQLNNLSHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDP
NTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPP
PPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSKAPTAAPPPPPPSRPGGLPPPPPN
RMYPPPPPALPPSPSGPPPPPPPVAVAGSMWPTTPPPPPPPPGPPPPPGLPSDGDHQVPT
PAGNKAAFLDQIREGTQLKRVEQNIRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTP
APTSGIVGALMEVMQKRSKAIHSSDEDEDEDDEEDFEDDDEWED
Download sequence
Identical sequences ENSVPAP00000002785 ENSVPAP00000002785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]