SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002843 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002843
Domain Number 1 Region: 327-419
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 8.01e-37
Family CAT-like 0.0000291
Further Details:      
 
Domain Number 2 Region: 50-143
Classification Level Classification E-value
Superfamily Single hybrid motif 6.67e-22
Family Biotinyl/lipoyl-carrier proteins and domains 0.00054
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000002843
Domain Number - Region: 200-233
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.0383
Family CAT-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002843   Gene: ENSVPAG00000003074   Transcript: ENSVPAT00000003075
Sequence length 424
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1063:268741:286112:1 gene:ENSVPAG00000003074 transcript:ENSVPAT00000003075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNCPLGRRSLPGISLCQGPVYPDSRKIVINNSSVFSIRFFRTSPVCKDDVITVKTPAFAE
SVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVHVPSPANGVIEALLVPDGGKVEGGTPL
FTLRKTGAAPAKAKPAEAPAAAAPKPEPAASAVPPPPAASIPTHMPPVPSPSQPLTSKPV
SAVKPTAAPAVAEPGVGKGLRSEHREKMNRMRQRIAQRLKEAQNTCALLTTFXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXTISELGEKARKNELAIEDMDGGTFTISNGGVFGS
LFGTPIINPPQSAILGMHAIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRRS
RAAV
Download sequence
Identical sequences ENSVPAP00000002843 ENSVPAP00000002843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]