SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002880 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002880
Domain Number 1 Region: 199-339
Classification Level Classification E-value
Superfamily PH domain-like 3.93e-44
Family Third domain of FERM 0.000000176
Further Details:      
 
Domain Number 2 Region: 496-583
Classification Level Classification E-value
Superfamily Moesin tail domain 3.14e-33
Family Moesin tail domain 0.0000198
Further Details:      
 
Domain Number 3 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 2.49e-27
Family Second domain of FERM 0.00000478
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.51e-26
Family First domain of FERM 0.00000611
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000002880
Domain Number - Region: 434-477
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0144
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002880   Gene: ENSVPAG00000003113   Transcript: ENSVPAT00000003113
Sequence length 604
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1966:932073:987691:-1 gene:ENSVPAG00000003113 transcript:ENSVPAT00000003113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLK
LNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE
TAVLLASYAVQAKYGDYNKEVHKPGYLANDRLLPQRVLEQHXXXXXXXXXXXXXXXXXXX
XXXREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLRQIEEQTMK
AQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSALAKQAADQMKNQEQLAAE
LAEFTAKIALLEEAKKKKEEEASEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIP
PTENEHDEHDENNAEASAELSSDGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARD
ETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAMWGPKLYALFQMRSCQSS
IKQM
Download sequence
Identical sequences ENSVPAP00000002880 ENSVPAP00000002880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]