SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002951 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002951
Domain Number 1 Region: 211-409
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 4.45e-61
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000169
Further Details:      
 
Domain Number 2 Region: 1-210
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.47e-60
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000741
Further Details:      
 
Domain Number 3 Region: 616-712
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.31e-16
Family AlaX-like 0.039
Further Details:      
 
Domain Number 4 Region: 467-502
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000971
Family AlaX-M N-terminal domain-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002951   Gene: ENSVPAG00000003189   Transcript: ENSVPAT00000003191
Sequence length 919
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_457:87371:110934:-1 gene:ENSVPAG00000003189 transcript:ENSVPAT00000003191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKPIFLNTIDPSHPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGD
YFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDDAKILP
GNMKDNFWEMGDTGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNRENDG
VLKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGADDA
DGIDMAYRVLADHARTITVALADGGRPDNTGRGYVLRRILRRAVRYSHEKLNASRGFFAT
LVDVVVQSLGDAFPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDNRTIPG
DTAGLLYDTYGFPVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGASGEDLIMLDIY
AIEELRERGLEATDDSPKYNYHSDSSGSYAFESAVATVMALRRDKMFVEEVSTGQECGVV
LDKTCFYAEQGGQIYDEGYLVKVDDSSEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXPVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLD
DPSGPAGSLTSVEFCGGTHLQNSSHAGAFVIVSEEAIAKGIRRIVAVTGAEAQKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXVLEKTKQLIDSNPNQPLVILMESGASAKALNEALKLFKTHSPQTSAML
FTVDNEAGKITCLCQVPQNAGYRGLKASEWVQQVTGLMDGKGGGKDVSAHARGKNEGCLQ
EALQLATSFAQLHERNVNN
Download sequence
Identical sequences ENSVPAP00000002951 ENSVPAP00000002951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]