SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003024 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003024
Domain Number 1 Region: 1-85,285-412
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.53e-31
Family FAD/NAD-linked reductases, N-terminal and central domains 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003024   Gene: ENSVPAG00000003269   Transcript: ENSVPAT00000003269
Sequence length 416
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1337:7817:17765:-1 gene:ENSVPAG00000003269 transcript:ENSVPAT00000003269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKKRVAVIGAGASGLTSIKCCLEEGLEPVCFERSDDIGGLWKFQENPEEGRASIYKSVI
INTSKERMCFSDYPITDSCYKFMHNSHVAYFRMYSKEFDLLKHIRFXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXVELSHTAKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALSQHPTVNDDLPNRIISGMVKVKT
NVKQFTETAAIFEDGSREEDIDAVIFATGYSFDFPFLEDSVKVVKNKISLYKKVFPPNLE
KPTLAIIGLIQPLGAIMPISELQGRWATQVFKGLKTLPSQSEMIREIAEVQEKIEK
Download sequence
Identical sequences ENSVPAP00000003024 ENSVPAP00000003024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]