SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003419 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003419
Domain Number 1 Region: 57-183
Classification Level Classification E-value
Superfamily C-type lectin-like 4.9e-33
Family C-type lectin domain 0.00055
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000003419
Domain Number - Region: 20-54
Classification Level Classification E-value
Superfamily SIS domain 0.0334
Family Phosphoglucose isomerase, PGI 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003419   Gene: ENSVPAG00000003686   Transcript: ENSVPAT00000003686
Sequence length 185
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_29:463376:471171:-1 gene:ENSVPAG00000003686 transcript:ENSVPAT00000003686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWHMIISTLIVVALKVVGMTLFLLYFPQIFGENNGRSYTTQSYGTVPQILGGNNVSVMP
RGSYRTACPRGWYFHQGRCYFLSISESPWNKSVESCKARGSTLAIVDTPEKLKFLQDIAG
AEKYFIGLMYQGKEKKWRWINNSPFNGNVTNQIQNFNCVTIGLTKTFDAVSCDIPYRSIC
EKGSN
Download sequence
Identical sequences ENSVPAP00000003419 ENSVPAP00000003419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]