SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003529 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003529
Domain Number 1 Region: 192-489
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.83e-108
Family Transglutaminase core 0.000000000051
Further Details:      
 
Domain Number 2 Region: 9-191
Classification Level Classification E-value
Superfamily E set domains 2.73e-57
Family Transglutaminase N-terminal domain 0.0000000224
Further Details:      
 
Domain Number 3 Region: 631-728
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.62e-27
Family Transglutaminase, two C-terminal domains 0.00000336
Further Details:      
 
Domain Number 4 Region: 586-629
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00000022
Family Transglutaminase, two C-terminal domains 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003529   Gene: ENSVPAG00000003800   Transcript: ENSVPAT00000003800
Sequence length 733
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1175:116808:252110:-1 gene:ENSVPAG00000003800 transcript:ENSVPAT00000003800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPSGTAFGGRRAVPRNASNAAENDPPTMEMQGLLPRGFHLQDYLNVTDVHLFKEKWDT
NKVDHHTDKYDNSKLIVRRGQAFYIQIDFNRPYDPTRDLFRVEYVIGRYPQENKGTYIPV
PIVSELQSGKWGAKVIMREDRSVRLSIQSSPNCIVGKFRMYVAVWTPYGIIRTSRNPETD
TYILFNPWCEEDAVYLENDKEREEYVLNDIGVIFYGDVNDIKSRSWSYGQFEDGILDACL
YIMDRAKMDLSGRGNPIKVSRVGSAMVNAKDDEGIIVGSWDNIYAYGIPPSAWTGSVDIL
LEYKSSENPVRYGQCWVFAGVFXXXXLRCLGIPARIVTNYFSAHDNDANLQLDIFLEEGG
NVDSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQVVDSTPQENSDGMYRCGPASVQAIK
HGHVCFQYDAPFVFAEVNSDLVYITAKKDGSHVVETVDTTHIGKLIVTKQIGGDGIKDIT
DTYKFQEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTREEVQIRAGEYMGQL
LEQAFLHFFVTARVNETKDVLAKQKSIVLTIPKVIIKVRGAQMVGSDMVVTVEFTNPLNE
TLRNVWIRLDGPGVTKPMRKMFREVRPNATVQWEEMLRPWVSGPRKLIASMSSDSLRHVY
GELDLQIQRRSSV
Download sequence
Identical sequences ENSVPAP00000003529 ENSVPAP00000003529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]