SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003681 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003681
Domain Number 1 Region: 1009-1264
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.7e-60
Family Complement components 0.00025
Further Details:      
 
Domain Number 2 Region: 1336-1468
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.75e-30
Family Alpha-macroglobulin receptor domain 0.000000986
Further Details:      
 
Domain Number 3 Region: 785-903
Classification Level Classification E-value
Superfamily E set domains 4.76e-26
Family SVA-like 0.01
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000003681
Domain Number - Region: 363-423
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00128
Family Invasin/intimin cell-adhesion fragments 0.0045
Further Details:      
 
Domain Number - Region: 26-78
Classification Level Classification E-value
Superfamily Pyridoxine 5'-phosphate synthase 0.0876
Family Pyridoxine 5'-phosphate synthase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003681   Gene: ENSVPAG00000003959   Transcript: ENSVPAT00000003963
Sequence length 1472
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_869:357239:395458:-1 gene:ENSVPAG00000003959 transcript:ENSVPAT00000003963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRNKLLQPRLSLLLLVFLHAEASVSGKPHYMVLVPSLLHTETPEQGCLVLSHLNEMVTV
SASLESLRENRSLFTDVVAEKDLFHCVSFTVPRSSFKEEVMFLTVHVKGPTHEFKKRTTV
LVKNKESLVFVQTDKPIYKPGQTVKFRVVSLDENFHPLNESSPLVYIEDPKGNRIAQWQN
LKLENGLKQLTFALSSEPISSYNVVVQRFSEKEHHFTVEXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXYTYGKPVPGHVTISMCRKYSNPSDCFDGESRAICETFSQELNSKGCFSQKVD
TKIFQMKRQGFEMKLEVEAKIQEEGTEVEFTGRGSTEITRTISKLSFVKVDPYIRQGIPF
FGQVLLVDGKGVPLPNKRIVITANEANYASNATTDEHGLVQFSISTTNLTDTSLTVKVQH
QDDNTCYGYLWLSKEHEEAYHTAYLVFSQSKSFVYLEPLPRELPCGQAQTVQVHYVLNGQ
VLQELKELEFYYLIMAKGGIVRTGTHVLPLEQGDMKGHFSMSFPVESDIAPIARLLIYAI
LPDGEVIGDSAKYEVENCLVNRVNLSFSSARSLPASRAHLRVTASPQSLCALRAVDQSVL
LMSPEAELSPASVYNLLPEKDLNGLPESLNQQEEDDGDCISHQNVYINGILYSPVTNTKE
KDMYSFLQDMGLKVFTNSKIHKPKLCPQPQQYEVHSAQRLLLSSPALVEMGRRHEIRNMI
HISEPPTETLRTYFPETWIWDLVVVKPSGVAELEVTVPDTITEWKAGALCLSSDTGLGLS
PTASLQVFQPFFVEVTIPYSVIRGEAFTLKATXXXXXXXXXXVSVHLEASPEFLAVPGEK
EQESHCICGDGRQTVSWAVTPKSNVKFSVSAEALDSQELCGTEAAVVPELGRKDTIIKPL
LVEPEGLEKEATFSSLLCPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYQRQLNYKHSDG
SYSTFGEKHGRSKGNTWLTAFVLKTFAQARAYIFIDEAHITDALTWLSQKQRDDGCFRSS
GSLLNNAIKGGVDDEVTLSVYITIALLEIPLPVTHVVVRNALFCLESAWKSAKEGAHGSH
VYIKALLAYAFARAGDQEKRREVLXXXXXXXXXXXNSTHWTRPQRPGASRGHFHRPRAPS
AEVEMTAYVLLAHLTAQPAPTPKDLASATRIVRWITKQHNFQGGSPSXXDTVVALHALSR
YGAATFTRTGKAAQVTIQSSGTFSTEFQVNNSNLLLLQQTSLPEVPGEYNVTATGQGCVY
LQTSLKYNILPKKEEFPFALEVQTVPQTCDGPKAHTSFQISLNVXXXXXXXXXXXXXXXX
XEMVSGFIPLKPTVKMLERSNHVSRTEVSNNHVLIYLDKVTNQTVGLSFTVLQDVPVRDL
KPAIVKVYDYYETDEFAVAEYNAPCSKDPGNV
Download sequence
Identical sequences ENSVPAP00000003681 ENSVPAP00000003681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]