SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003694 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003694
Domain Number 1 Region: 28-223,265-520
Classification Level Classification E-value
Superfamily Sema domain 1.02e-166
Family Sema domain 0.0000000000000459
Further Details:      
 
Domain Number 2 Region: 516-567
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000101
Family Plexin repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 585-668
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000213
Family V set domains (antibody variable domain-like) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003694   Gene: ENSVPAG00000003977   Transcript: ENSVPAT00000003977
Sequence length 772
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3219:1077723:1285147:-1 gene:ENSVPAG00000003977 transcript:ENSVPAT00000003977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWFARIVCLFWGVLLTARANYQNGKNNVPRLKLSYKEMLESNNVITFNGLANSSSYHTF
LLDEERSRLYVGAKDHIFSFNLVNIKDFQKIVWPVSYTRRDECKWAGKDILKECANFIKV
LKAYNQTHLYACGTGAFHPICTYIEIGHHPEDNIFKLEDSHFENGRGKSPYDPKLLTASL
LIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDFGGHRSLVNKWTTFLKARLICSVPGPNG
IDTHFDELQDVFLMHSKDPKNPVVYGVFTTSSNIFRGSAVCMYSMSDVRRVFLGPYAHRD
GPNYQWVPYQGRVPYPRPGTCPSKTFGGFDSTKDLPDDVITFARSHPAMYNPVFPINNRP
IMIKTDVNYQFTQIVVDRVDAEDGQYDVMFIGTDVGTVLKVVSIPKETWHDLEEVLLEEM
TVFREPTIISAMELSTKQQQLYIGSTAGVAQLPLHRCDVYGQACAECCLARDPYCAWDGS
SCSRYFPTAKRRTRRQDIRNGDPLTHCSDLQHHDNHHGHSLEERIIYGVENSSTFLECSP
KSQRALVYWQFQRRNEERKEEIRVDDHIIRTEQGLLLRSLQRKDSGSYLCHAVEHGFMQT
LLKVTLEVIDTEHLEELLHKDEDGDGSKTKEMSNSMTPSQNVWYRDFMQLINHPNLNTMD
EFCEQVWKRDRKQRRQRPGHTQGNSNKWKHLQENKKGRNRRTHEFERAPRSV
Download sequence
Identical sequences ENSVPAP00000003694 ENSVPAP00000003694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]