SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003712 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003712
Domain Number 1 Region: 248-419
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.15e-59
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000207
Further Details:      
 
Domain Number 2 Region: 418-531
Classification Level Classification E-value
Superfamily E set domains 1.04e-30
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003712   Gene: ENSVPAG00000003995   Transcript: ENSVPAT00000003995
Sequence length 1507
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_622:617531:672145:1 gene:ENSVPAG00000003995 transcript:ENSVPAT00000003995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVYDLLPKELQLPPSRETSVASMSQTSGGEAGSPPPAVVAADASSAPSSSSMGGACSSFT
TSSSPTIYSTSVTDSKAMQVESCSSALGVSNRGVSEKQLTSNTVQQHPSTPKRHTVLYIS
PPPEDLLDNSRMSCQDEGCGLESEQSCSMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRN
PKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGTLENQKGTGVKK
SPMLCGQYPVKSEGKELKIVVQPETQHRARYLTEGSRGSVKDRTQQGFPTVKLEGHNEPV
VLQVFVGNDSGRVKPHGFYQACRVTGRNTTPCKEVDIEGTTVIEVGLDPSNNMTLAVDCV
GILKLRNADVEARIGIAGSKKKSTRARLVFRVNITRKDGSTLTLQTPSSPILCTQPAGVP
EILKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDENSWKSEAEIDMELFHQNHLI
VKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPDPAAATALNVNVKKEISSPARP
CSFEEAMKAMKTTGCNLDKVNILPNALITPLISSSMIKSEDVTPMEVTAEKRSSPIFKTT
KTVGSTQQTLENISNIAGNGSFSSSSSSHLPSENEKQQQIQPKAYNPESLTTIQTQDISQ
PGTFPAVSASSQLPNSDALLQQATQFQTRETQSREVLQSDGTVVNLSHLTEASQQQQQSP
LQEQAQTLQQQISSSIFPSPNSVSQLQSTIQQLQAGSFTGSTASGSNGNVDLVQQVLEAQ
QQLSSVLFSAPDGNENVQEQLSADIFQQVSQIQNSVSPGMFSSAEPAVHTRPDNLIAGRA
ESVHPQTENTLSNQQQQQQQQQVMESSAAMVIEMQQSICQAAAQIQSELFPSTASANGNL
QQSPVYQPTSHMMSALSTNEDMQMQCELFSSSPAVSGNETATTTTQQVATPGTTMFQTSG
SGDGEETGAQAKQIQNSVFQTMVQMQHSGDSQSQVNLFSSTKGMMSVQNSGTQQQGNGLF
QQGNEMMSLQSNFLQQSSHSQAQLFHPQNPIADAQNLSQEPQGSIFHSPSPIVHSQTSTT
SSEQMQPPMFHSQNTMAVLQGSSVPQDQQSANIFLSQSPMNNLQTNTVAQEEQITFFAAQ
NSISPLQSTSNTEQQAAFQQQAPISHIQTPMLSQEQAQPAQQGLFQPQVPLGSLPPNPMP
QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCSQLLTSGPA
TLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQG
NNLTGSF
Download sequence
Identical sequences ENSVPAP00000003712 ENSVPAP00000003712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]