SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003843 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003843
Domain Number 1 Region: 23-146
Classification Level Classification E-value
Superfamily Lysozyme-like 2.39e-44
Family C-type lysozyme 0.0000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003843   Gene: ENSVPAG00000015502   Transcript: ENSVPAT00000004138
Sequence length 148
Comment pep:novel scaffold:vicPac1:scaffold_21099:1215:4770:-1 gene:ENSVPAG00000015502 transcript:ENSVPAT00000004138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSLLLVSLASCLLAIKQASPISRCDLAKVLREEDLDGFEGYSLSDWLCLAFVESAFNIT
KVDENTDGSFDYGIFQINSHYWCNDYQSHTENICHMDCQELLSPNLLSIINCAKKIVSGA
GGMKNWVKWRLHCAGRPLSYWMTGCHLG
Download sequence
Identical sequences ENSVPAP00000003843 ENSVPAP00000003843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]