SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004048 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004048
Domain Number 1 Region: 82-233
Classification Level Classification E-value
Superfamily E set domains 1.08e-49
Family RhoGDI-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004048   Gene: ENSVPAG00000004356   Transcript: ENSVPAT00000004356
Sequence length 237
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_41:148441:249680:-1 gene:ENSVPAG00000004356 transcript:ENSVPAT00000004356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKGDGRETKEPAPEASGRENPKPEPQAESESGSESELEAGPGLEDPTPLQRKPPIGPEDV
LGLQRITGXXXXXXXXXXXXXPLDFVRFKNRDMDSGTVLFEIKKPPASERLPINLRDLDP
NAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCI
PSSKNTCEHIYDFPPLSEELINEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
Download sequence
Identical sequences ENSVPAP00000004048 ENSVPAP00000004048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]