SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004558 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004558
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.35e-24
Family Voltage-gated potassium channels 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004558   Gene: ENSVPAG00000004921   Transcript: ENSVPAT00000004920
Sequence length 217
Comment pep:known_by_projection scaffold:vicPac1:scaffold_1729:264965:268469:-1 gene:ENSVPAG00000004921 transcript:ENSVPAT00000004920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YGHTVPLSDGGKAFCIVYSVIGIPFTLLFLTAVVQRVTIHVTRRPVLYVHVRWGFSKQVV
AIVHAVLLGFLTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQ
KFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQL
SFSSITDQAAGAKEDQKQNEPFVAPPSPAMADGSTSQ
Download sequence
Identical sequences ENSVPAP00000004558 ENSVPAP00000004558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]