SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004607 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004607
Domain Number 1 Region: 36-96,127-300
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.98e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004607   Gene: ENSVPAG00000004971   Transcript: ENSVPAT00000004970
Sequence length 695
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1486:131196:172428:1 gene:ENSVPAG00000004971 transcript:ENSVPAT00000004970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSLQGCGRRVAASLSKQHLPSARFSGDRAAPGTPHFDVVVIGGGHAGTEAAAAAARCGS
RTLLLTHRVDTIGQMSCNPSFGGIGKGHLMREVDALDGLCARICDQSGVHYKVLNRRKGP
AVWGLRAQIDRKLYKQNMQKEILNTPLLAVREGAVEDLLLAKPEPQRPGSFRVRGVVLVD
GSAVYAESVVLTTGTFLRGMVVIGLETHPAGRLGDQPSVGLAQTLEKLGFVVGRLKTGTP
PRITKESVNFSILNKQTPDDPSVPFSFINETVWIKPEDQLPCYLTHTDPRVDEIVLENLH
LNSHIKETTRGPRYCPSIESKVLRFPNRRHQVWLEPEGLDSDLIYPQGLSMTLPAELQEK
VITCIRGLEKAKVVQPASLLYGVQYDYLDPRQISPSLETQLVQRLFFAGQINGTTGYEEA
AAQGVIAGINASLRVRRKPPFVVSRTEGYIGVLVDDLTTLGASEPYRMFTSRAEFRLSLR
PDNADSRLTLRGYEEAGCVSQQRFERASQMKASLEEGISVLKSIQLSSSKWKNLIPEASI
SIDRGVPLSALDILKYEEVHMELLAAVAPAPLQKYAECRELAERLKIEXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGAASRIPGVTPAAVTNL
LRFVKTAQRRQAAKHRLPNPEQRLCAADRLQERQL
Download sequence
Identical sequences ENSVPAP00000004607 ENSVPAP00000004607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]