SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004611 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004611
Domain Number 1 Region: 34-210
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.19e-54
Family F-box associated region, FBA 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004611   Gene: ENSVPAG00000004974   Transcript: ENSVPAT00000004974
Sequence length 214
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2283:5852:8696:-1 gene:ENSVPAG00000004974 transcript:ENSVPAT00000004974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGLRLKNLDRDQRAMWPVVCRCLPSADAASACLLGRFCARGPIGRNLLRNPKSKNGFQKW
MRLSDGDDWSLQESRIPGLPYLTYLLSAYRCCYRKKVLDLEEEGFWPELLDSGKMEIYVS
HRRTDRQGTDCIYQLIVRLLDANQAVLDHFSPKPFPIRKWRNSVSHHVSHVFSNLKKGVR
FVSFEHWMWDLEFCSEQCGVYLTNSSVIVSIRLF
Download sequence
Identical sequences ENSVPAP00000004611 ENSVPAP00000004611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]