SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004656 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004656
Domain Number 1 Region: 105-680
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 2.12e-188
Family Myeloperoxidase-like 0.00000000000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004656   Gene: ENSVPAG00000005021   Transcript: ENSVPAT00000005021
Sequence length 683
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2578:34692:98872:1 gene:ENSVPAG00000005021 transcript:ENSVPAT00000005021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTTAAAMSDAVRQVKAHVNKAFLDSRTRLKAAMSSEVPTTRQLSEYLKHAKGRTRTAIHN
GQVWEESLKRLWQKVTQTNVTDPSLDLTALSWEVGCDVPVSVVKCDENSSYRTITGDCNN
GRHPALGAANQALAHWLPAEYEDGLSLPFGWTRGKRRNGFPLPLAREVSNKIVGYLNEEG
VLDQNRSLLFMQWGQIVDHDLDFSPDTELGSSEYSKAQCDEHCIQGDNCFPIMFPRNDRK
VMTQGKCMPFFRAGFVCPNPPYQSLAREQINALTSFLDASLVYGSEPSLASRLRDLSSPL
GLMAVNQEFWDHGLAYPPFVNKKPSPCEVINTTAQVPCFLAGDSRASEQILLAASHTLLL
REHNRLARELKRLNPRWDGEKLYQEARKILGAFMQIITFRDYLPIVLGDEMQKWIPPYRG
YNKSVDPRISNVFTFAFRFGHLEVPSTMSRLDENYQPWGPEPELPHTLFFNTWRIVKDGG
IDPLVRGLLAKKSKLLSQKRMMTGDLRNKLFQPPYTIHGFDLAAINIQRCRDHGMPGYNS
WRGFCDLSQPQTLKELHAVLKNKKLAKKLLDLYRTPDNIDIWLGGIAEPLVKRGRVGPLL
ACLLGRQFRQIRDGDRFWWENPGVFTKKQQKSLQKMSFSCLVCDNTHITKVPLHPFQSNS
YPHGFVDCSAIDKLDLSPWASEN
Download sequence
Identical sequences ENSVPAP00000004656 ENSVPAP00000004656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]