SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004728 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004728
Domain Number 1 Region: 886-959,1044-1104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000455
Family Growth factor receptor domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004728   Gene: ENSVPAG00000005100   Transcript: ENSVPAT00000005100
Sequence length 1276
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_380:218817:300905:-1 gene:ENSVPAG00000005100 transcript:ENSVPAT00000005100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAGNHWPEGNTEPHIENITFDQNQVDFSTVVSKEGVMVQTPRKRHASSDAPENFTPQTET
AAARGRNDSSRTTNFTISPVGAERSTALTSQSITLALGGRPPPSSSAGSEGRTAPSHTES
STSSAPARGQGLPEIMTLHTQVVATSVVSQSSLPAVDVGEETTLPRQRNSSRPEQSWLPF
SRTPVYSPPSSSPTPSESTEDLNNSTALPSISVSGTGSVQVATMFPNGAPRMLQSLSVSL
GPPPETEHFSEDSETAATSASVHSSPSGADLRRNGGEIGSLGERKLIEPSTENGFGLTSS
EVSVVLLQNDSLTSGGHQLASRSEAGSRSPVSQTETAPQPAPSVRGGQSTAHWSSTNRGT
FTDVTRSVTSHPQVVNSSVWSQFSASAPQSRGSDTALGDRSSSESSSSSSSESLDSWAPH
GERWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSCATNPCLHDGKCIMDST
SRGYRCLCSPSWQGDDCSVDVNECLSSPCPPLAVCNNTQGSFTCRCPVGYQLEKGICNLI
RTFVTEFKIKKTFLNTTVEKHSDLREVENEITKTLNMCFSTLPGYTRSTAHASREFSAVV
MSLQATFSLASNVTLFDLVDGMQRCVNSCRSSAELCQLLGSQRRLFRAGSLCKRKTPECD
KETSICTDLDGVALCQCKSGYFQFNKMDHSCRXXXXXXXXXXXXXXXXXXXXXXXXXXXX
YQLITVVIGAAGGGLLLILGIALIVTCCRKNKNDISKLIFKSGDFQMSPYAEYPKNPRSQ
EWGRETIEMHKNGSTKNLLQMTDVYHSPTSVRNPELERNGLYPAYTGLPGSRHSCIFPGQ
YNPSFISDESRRRDYF
Download sequence
Identical sequences ENSVPAP00000004728 ENSVPAP00000004728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]