SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004756 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004756
Domain Number 1 Region: 301-444
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 8.17e-57
Family PDEase 0.0000299
Further Details:      
 
Domain Number 2 Region: 78-280
Classification Level Classification E-value
Superfamily GAF domain-like 1.94e-42
Family GAF domain 0.00016
Further Details:      
 
Domain Number 3 Region: 504-608
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.08e-26
Family PDEase 0.0000498
Further Details:      
 
Domain Number 4 Region: 1-94
Classification Level Classification E-value
Superfamily GAF domain-like 1.57e-24
Family GAF domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004756   Gene: ENSVPAG00000005129   Transcript: ENSVPAT00000005129
Sequence length 618
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_984:1120718:1471159:-1 gene:ENSVPAG00000005129 transcript:ENSVPAT00000005129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQMYLP
FCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKCERCS
VLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSVAELVASTGL
PVNISDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFDDADQ
RLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSSAELDKFRAANIPLVS
ELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRMVLYH
NWRHAFNVCQLMFAMLTTAGFQEILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSGSALA
QLYGTSATLEHHHFNHAVMILQSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXSMLMTACDLGAVTKPWEISRQVAELVTSEFFEQGDR
ERAELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDVAVNRSKW
EELHQKLVSAASPSASLM
Download sequence
Identical sequences ENSVPAP00000004756 ENSVPAP00000004756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]