SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004767 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004767
Domain Number 1 Region: 201-327
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 2.09e-27
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000264
Further Details:      
 
Domain Number 2 Region: 2-47
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000393
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000004767
Domain Number - Region: 412-447
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000222
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004767   Gene: ENSVPAG00000005140   Transcript: ENSVPAT00000005140
Sequence length 459
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_78:210:6259:1 gene:ENSVPAG00000005140 transcript:ENSVPAT00000005140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLATAVVQLYLALPPGADHWTKKHCGAVCFVKDNPQKSYFIRLYGLQXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXHVSHVGWDPQNGYDVNNLDPDLRNLFSRAGISEAQLTDA
ETSKFIYEFIENQGGLEAVRKEMRRQDPLPPPPPPSRGGNQHLRPPIGGGNKGRCGPLPP
VPSGGAPPPPTPRGPPPPGRGGPPPPPPPATGRSAPLPPPPAGAGGLLLPLXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPGAPESSALQPPPQSS
EGLVGALMHVMQLQCGGIHSSDEGEDQAGDDDDDDEWDD
Download sequence
Identical sequences ENSVPAP00000004767 ENSVPAP00000004767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]