SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004772 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004772
Domain Number 1 Region: 1-117
Classification Level Classification E-value
Superfamily Globin-like 6.17e-34
Family Globins 0.0000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004772   Gene: ENSVPAG00000005146   Transcript: ENSVPAT00000005145
Sequence length 121
Comment pep:known_by_projection scaffold:vicPac1:scaffold_284098:140:768:1 gene:ENSVPAG00000005146 transcript:ENSVPAT00000005145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSAQERAHIAQVWDLIAGHEAPFGAELLLRLFAVYPNTKTYFKHLGDCPDEVLLLNHGQ
RMLEAVGVAVRHVDNLRAALSPLADLHAHMLGVDPTNFPLLIQCFQVVLASHLQDFTVQM
Q
Download sequence
Identical sequences ENSVPAP00000004772 ENSVPAP00000004772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]