SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004774 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004774
Domain Number 1 Region: 1-227
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.89e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0037
Further Details:      
 
Domain Number 2 Region: 310-484
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000259
Family FAD/NAD-linked reductases, N-terminal and central domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004774   Gene: ENSVPAG00000005147   Transcript: ENSVPAT00000005147
Sequence length 532
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1022:1412862:1446419:1 gene:ENSVPAG00000005147 transcript:ENSVPAT00000005147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKRVAIIGAGVSGLAAIRSCLEEQLEPICFEKGKDVGGLWKYSDHPEEGRASIYRSVFT
NSSKEMTCFPDFPCPDDYPNFMHNSKLQEYITMFAKEKNLLRYIQFKTTVSSVNKRPDFS
TTGQWDVTTEKDGKTESAIFDAVLICSGHHVYPNLPKESFPGINLFKGKCFHSRDYKEPG
IFKGKRVLVIGLGNSGCDIATELSHIAGKVIISSRRGSWVMSRVWDDGYPGNMMSVTRFE
IFLKNALPKAISDWWYMKQMNARFKHENYGLMPLHGTLRKEPVFNDELPARILCGTVSVK
PNVKEFTETSAIFEDGTMFEAIDCVIFATGYTYAYPFLDDSIIKSRDNEVTLFKGVFPPP
LEKPTLAVIGLVQSLGAAIPTADMQARWAVQVLKGTCTLPSVKDMMNDIDEKMGKKLKWF
GKSDTILTDYIAYVDELASFIGAKPNILWLFLTDPKLALEVYFGPCSPYQFRLVGPGKWP
GARHAILTQWDRSLKPMRTRAVGNPVKPCLFHSWFRPVAISVVSVAIFLLLI
Download sequence
Identical sequences ENSVPAP00000004774 ENSVPAP00000004774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]