SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004775 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004775
Domain Number 1 Region: 1-229
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.23e-55
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0048
Further Details:      
 
Domain Number 2 Region: 312-491
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.18e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004775   Gene: ENSVPAG00000005148   Transcript: ENSVPAT00000005148
Sequence length 539
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1022:1460376:1476038:1 gene:ENSVPAG00000005148 transcript:ENSVPAT00000005148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKRVAIIGAGVSGLASIRCCLEEGLEPTCFERSNDVGGLWQFSDHTEEGRASIYQSVFT
NSSKEMMCFPDFPYPEDYPSYMHQSKLQEYIKTFALKKNLLRYIQFETLVSSIKKCPSFL
VTGQWEIVSEKDGKQESAIFDAVMICSGHHVYPNLPTDSFPGLDQFQGRYLHSRDYKGPG
GFQGKRVLVIGLGNSGCDIAVELSRLAAQVIISTRSGSWVMSRVWDDGYPWDMVYVTRFA
SFLRNALPSFVSDWLYVKKMNTWFKHENYGLMPLNGTLRKEPVFNDELPSRILCGTVSIK
PSVKEFTETSAIFENGTMFEAIDFVIFATGYGYAYPFLDDSIIKSRNNEVTLYKGIFPPL
MEKPTLAVIGLVQSLGAAIPTADLQARWAVKVFSNSCTLPTTNEMMDDIDEKMGKKLKCI
FFSFLRFGQSQTLQTDYITYMDELGSFIGAKPNIPRLFLTDPQLALEVYFGPCSPYQFRL
MGPGKWDGARNAILTQWDRTVKPTRTRAVGEAKRPQPFYNLLKMLLLPVLVLTVLLTFY
Download sequence
Identical sequences ENSVPAP00000004775 ENSVPAP00000004775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]