SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004897 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004897
Domain Number 1 Region: 40-489
Classification Level Classification E-value
Superfamily Sema domain 1.19e-137
Family Sema domain 0.000000135
Further Details:      
 
Domain Number 2 Region: 840-892
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 4.71e-16
Family TSP-1 type 1 repeat 0.0004
Further Details:      
 
Domain Number 3 Region: 594-644
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000353
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 4 Region: 485-533
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000968
Family Plexin repeat 0.0032
Further Details:      
 
Domain Number 5 Region: 895-940
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000536
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 649-684
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000314
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004897   Gene: ENSVPAG00000005274   Transcript: ENSVPAT00000005276
Sequence length 1073
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_907:274627:592512:-1 gene:ENSVPAG00000005274 transcript:ENSVPAT00000005276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGPCVIAWLFSSLGWWRLAQPETDTSQCQRAEHPVISYKEIGPWLREFRGKNAVDFLQL
TFDPGQKELVVGARNYLFRLQLEDLSLIQAVEWECDETTKKACYSKGKSKEECQNYIRVL
LVGGDRLFTCGTNAFTPVCTNRTLSNLTEIHDQISGMARCPYSPQHNSTALLTAGGELYA
ATAMDFPGRDPAIYRSLGILPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRENAVEHD
CGKTVFSRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQGTFFLPELD
LIYGIFTTNVNSIAASAVCVFNLSAISQAFNGPFKYQENSRSAWLPYPNPNPNFQCGTMD
QGLYVNLTERNLQDAQKFILMHEVVQPVTAVPAFMEDNSRFSHVAVDVVQGRDALVHIIY
LATDYGTIKKVRAPLTQTSGSCLLEEIELFPERRPEPVRSLQILHSQSVLFVGLREHVAK
IPLKRCPFHRTRSACIGAQDPYCGWDVVMKTCTSLEESLSMTQWEQSISTCPXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNGGWTPW
TSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHMFWTGWGP
WERCTAQCGGGIQARRRTCENGPDCAGCNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXD
GMWSCWSPWSKCSATCGGGHYMRTRSCTNPAPAYGGDICLGLHTEEALCNTQPCPESWSE
WSDWSECDVSGVQVRVRQCILLFPVGSQCSGNTSESRPCVFDSNFIPXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXAFNKNNLILEERNRYFNPHLTGKTYSNAYFTDLNNYDDY
Download sequence
Identical sequences ENSVPAP00000004897 ENSVPAP00000004897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]