SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004941 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004941
Domain Number 1 Region: 27-128
Classification Level Classification E-value
Superfamily E set domains 0.00000000000005
Family Filamin repeat (rod domain) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004941   Gene: ENSVPAG00000005322   Transcript: ENSVPAT00000005322
Sequence length 502
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_608:1548191:1557704:-1 gene:ENSVPAG00000005322 transcript:ENSVPAT00000005322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSILLLYCFFLGTVPALAETGGEGRLSPERSEIWGPGLKAAVVLPARYFYIQAVDTSGN
KFTSSPGEKVFQIKISAPDEQFTRVGVQVLDRKDGSFIVRYRMYASYKNLKIEVKFQGQH
VAKSPYILKGPVYHENCDCPLEDSAAWLREMNCPETITQIQRDLAHFPTVDPEKIAAEIP
KRFGQRQSLCHYTLKDNKVYIKTHGEHVGFRIFMDAILLSLTRKVKMPDVEFFVNLGDWP
LEKKKSSSHIHPIFSWCGSTDSKDIVMPTYDLTDSVLETMGRVSLDMMSVQANTGPPWES
KNATAVWRGRDSRKERLELVKLSRKHPELIDAAFTNFFFFKHDESLYGPLVKHISFFDFF
KHKYQINVDGTVAAYRLPYLLVGDSVVLKQDSIYYEHFYNELQPWKHYIPVKSNLSDLLE
KLQWAKDHDEEAKKIAKTGQEFARNNLMGDDIFCYYFKLFQEYASLQVSEPQIREGMKRV
EPQTEDDLFPCTCHRKKTKDEL
Download sequence
Identical sequences XP_006208364.1.17985 ENSVPAP00000004941 ENSVPAP00000004941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]