SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005042 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005042
Domain Number 1 Region: 336-478,537-620
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.26e-49
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000155
Further Details:      
 
Domain Number 2 Region: 123-230
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 9.03e-22
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0022
Further Details:      
 
Domain Number 3 Region: 603-678
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.00000000000000483
Family Anticodon-binding domain of Class II aaRS 0.003
Further Details:      
 
Domain Number 4 Region: 61-122
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000698
Family TGS domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005042   Gene: ENSVPAG00000005427   Transcript: ENSVPAT00000005427
Sequence length 688
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2986:448751:474514:1 gene:ENSVPAG00000005427 transcript:ENSVPAT00000005427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLCQRWRLLRLPGFQACGLHTAAVPTPPNWLVERRGLFEELWTAQVKRLASMAQKEHRA
IKISLPGGQKVDAVAWKTTPYQLAQQISSKLADTAVAAQVNGEPYDLERPLETDSDLRFL
TFDSPEGKAVFWHSSTHVLGAAAEQLLGAVLCQGPSTECGFYHDFFLGKERTVRGSELPA
LERVCRELAAAAQPFRRLEASQDQLRQLFKDNPFKLRLIEKVTGPTATVYGXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVAFIRAEYTRRGFSEVKKNTLFSTKL
WEQSGHWEHYREDMFALQTPGSDRPTCSQSDHHTSHPTDTLALKPMNCPAHCLMFAHRPR
SWRELPLRLADFGALHRAEASGSLGGLTRLRRFQQDDAHIFCAPAQXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXID
VHLHDALGRPHQCGTIQLDFQLPLRFDLQYRGQAGALERPVLIHRAVLGSVERMLGVLAK
SCGGKWPLWLSPFQVVVIPVGAEQEEYARELAHYNFLFVVGQKEQTKRTVNIRTRDNRQL
GERDLAEAAQRLLELQNSRAPNAEEMFC
Download sequence
Identical sequences ENSVPAP00000005042 ENSVPAP00000005042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]