SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005120 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005120
Domain Number 1 Region: 252-516
Classification Level Classification E-value
Superfamily Kelch motif 4.97e-32
Family Kelch motif 0.012
Further Details:      
 
Domain Number 2 Region: 608-777
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-26
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 3 Region: 1-114
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-20
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 914-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000013
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000005120
Domain Number - Region: 105-185,600-639
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0816
Family Growth factor receptor domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005120   Gene: ENSVPAG00000005508   Transcript: ENSVPAT00000005509
Sequence length 1279
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2496:675953:1294394:1 gene:ENSVPAG00000005508 transcript:ENSVPAT00000005509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTEPSGYLTDGPINYKYKTKCTWLIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYAP
LIAVLSGLIVPEIRGNETVPEVVTTSGYALLHFFSDAAYNLTGFNIFYSINSCPNNCSGH
GKCTTSISVPSQVYCECDKYWKGEACDIPYCKANCGSPDHGYCDLTGEKLCVCNDSWQGP
DCSLNVPSTESYWILPNVKPFSPSVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLNYNL
ESSIWNVGTVSRGPLQRYGHSLALYQENIFMYGGRIETSDGNVTDELWVFNIHSQSWSTK
TPTVLGHGQQYAVEGHSAHIMELDSRDVVMIIIFGYSAIYGYTSSIQEYHILSNTWLVPE
TKGAIVHGYGHTSVYDEIMKSIYHGGYKALPGNKYGLVDDLYKYEVNTKTWTIMKESGFA
RYLLSAVLINGAMLIFGGNTHNDTFSCNGGKXXXXXXXXXXXXCDEWKILPKPNLHRDVN
RFGHSAVVINGSMYIFGGFSSVLLNDILVYKPPNCKAFRDEELCKNAGPGIKCIWNKNHC
ESWESGNTNNILRAKCPPKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
SVKNYTKCHVRNEQICNKLTSCKSCSLNLNCQWDQRQQECQALPAHLCGEGWNHIGDACL
RVNSSRENYDNAKLYCYNLSGNLASLTTSKEVEFVLDEIQKYTQQKVSPWVGLRKINISY
WGWEDMSPFTNTTLQWLPGEPNDSGFCAYLERAAVAGLKANPCTSMADGLVCEKPVVSPN
QNARPCKKPCSLRTSCSNCTSNGMECMWCSSTRRCVDSNAYIISFPYGQCLEWQTATCSP
QNCSGLRTCGQCLEQPGCGWCNDPSNTGRGHCVEGSSRGPMKLIGMHNNEMVLDTSLCPK
EKNYEWSFIQCPACQCNGHSTCINNNVCEQCKNLTTGKQCQDCMPGYYGDPTNGGQCTAC
CSGHANTCHMHTGKCFCTTKGIKGDQCQLCDSENRYVGNPLRGTCYYSLLIDYQFTFSLL
QEDDRHHTAINFIANPEQSNKNLDISINASNNFNLNITWSVGSTAGTISGEETPIVSKMN
IKEYRDSFSYEKFNFRSNPNITFYVYVSNFSWPIKIQIAFSQHNTIMDLVQFFVTFFSCF
LSLLLVAAVVWKIKQTCWASRRREQLLRERQQMASRPFASVDVALEVGAEQTDFLRGSLE
GAPKPIAIEPCAGNRAAVLTVFLCLPRGSSGAPPPGQSGLAIASALIDISQQKPSDSKDK
ASGARNRKHHLSTRQGTCV
Download sequence
Identical sequences ENSVPAP00000005120 ENSVPAP00000005120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]