SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005192 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005192
Domain Number 1 Region: 189-317,371-443
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 2.59e-22
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.019
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000005192
Domain Number - Region: 499-559
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000241
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005192   Gene: ENSVPAG00000005586   Transcript: ENSVPAT00000005586
Sequence length 781
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_396:969820:1033762:-1 gene:ENSVPAG00000005586 transcript:ENSVPAT00000005586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WSGPVGVSWGLRAAASEGPAPRGGRWRRRVFEEDEDCGGVQDFVARLANNTHQHVFDDLS
GSVSLSWVGDTTGIILVLTTFHVPLVIMTFGQSKLYRXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXNGLWVSKNFGGKWEEIHKAVCLAKWGSGNTIFFTTYVNGSCKADLGALELRRT
SDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQ
FYSILAANDDMVFMHVDEPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXNSIQTMITFDQGGRWKHLRKPENSECDATAKNKNECSLHIHASYSIS
QKLNVPMAPLSEPNAVGIVIAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXFSTDEGQCWQTYMFTREPIYFTGLASEPGARSMNISIWGFT
ESFLTRQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPGDYGDGCILGYKEQYLRLRKSS
VCQNGRDYVVTKQPSVCPCSLEDFLCDFGYFRPENDSKCVEQPELKGHDLECLYGREEHL
TTNGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSKSNSVPIILATVGLMLVT
VVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLL
E
Download sequence
Identical sequences ENSVPAP00000005192 ENSVPAP00000005192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]