SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005299 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSVPAP00000005299
Domain Number - Region: 216-249
Classification Level Classification E-value
Superfamily Plexin repeat 0.034
Family Plexin repeat 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005299   Gene: ENSVPAG00000005701   Transcript: ENSVPAT00000005701
Sequence length 414
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1734:229555:301472:-1 gene:ENSVPAG00000005701 transcript:ENSVPAT00000005701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDHSYYVSRLYGPSEPRSRELWVDVAKANQSQVKVHRILSNTHRQASRVVLSFDFPFYGH
PLRQITIATGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXSRRRTIFEYHRVELDPSKITSTSAVEFTPLPTCLQHRSLDACMSSDLTFNCSWCH
VLQRCSSGFDRYRQEWLAYGCAQEAEGKTCADFQDEDSFSSSPDSSSSPFDGDLTTTSSS
LFIDSLTTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXRKPHHWPAMKFRILPYHSTYSEFEPSGPEKEGFVDAKQC
Download sequence
Identical sequences ENSVPAP00000005299 ENSVPAP00000005299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]