SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005317 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005317
Domain Number 1 Region: 2-508
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 4.47e-172
Family Myeloperoxidase-like 0.00000000000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005317   Gene: ENSVPAG00000005725   Transcript: ENSVPAT00000005725
Sequence length 509
Comment pep:known_by_projection scaffold:vicPac1:scaffold_3814:100340:107911:-1 gene:ENSVPAG00000005725 transcript:ENSVPAT00000005725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRAVSNQIVRFPSERLTSDRGRSLMFMQWGQFIDHDLDFAPESPARVAFTTCAQLPPCFP
IKIPPNDPRISNQRDCIPFFRSAPACPRNRNKVRNQINTLTSFVDASMVYGSEVSLALRL
RNRTNHLGLLAINQRFQDNGRALLPFNNLHDDPLLTNRSARIPCFLAGDTRSTETPKLAA
MHTLFVREHNRLATELRRLNPRWTGDKLYQEARKILGAMVQIITYRDFLPLVLGRARASR
TLGPYRGYCSNVDPRVANVFTLAFRFGHTMLQPFMFRLDSQYRASAPNSRVPLSSAFFAS
WRIVHEGGIDPILQGLMATPAKLNRQDSMLVDELRDRLFRQVRRIGLDLAALNMQRSCDH
GLPGYNAWRRFCRLSQPRNLAQLSQVLNNRDLARKFLSLYGTPDNIDIWIGAIAEPLLPG
ARVGPLLACLFENQFTRARNGDRFWWQKRGVFTKRQRQALRQISLSRIVCDNTGITIVPR
DIFKANTYPLGFVNCNSIPRLNLSAWRGT
Download sequence
Identical sequences ENSVPAP00000005317 ENSVPAP00000005317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]