SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005395 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005395
Domain Number 1 Region: 240-428
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-37
Family Laminin G-like module 0.00000535
Further Details:      
 
Domain Number 2 Region: 443-642
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.12e-29
Family Laminin G-like module 0.0000465
Further Details:      
 
Domain Number 3 Region: 15-67
Classification Level Classification E-value
Superfamily GLA-domain 1.33e-20
Family GLA-domain 0.00046
Further Details:      
 
Domain Number 4 Region: 94-222
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000001
Family Growth factor receptor domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000005395
Domain Number - Region: 215-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000692
Family EGF-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005395   Gene: ENSVPAG00000005807   Transcript: ENSVPAT00000005810
Sequence length 649
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3157:200823:237924:-1 gene:ENSVPAG00000005807 transcript:ENSVPAT00000005810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSKQHASQVLVRKRRANSMLEETKKGNLERECIEELCNKEEAREVFENDPETEYFYPKYL
GCLGSFRAGLFTAVPLSTNAYPDLRSCVNAIPDQCNPLPCNEAGYLICKDGQAAFTCICK
SGWQGEKCELDINECKDPSNVNGGCSQICDNILGSYYCSCKSGFVMLSNKKDCKDIDECS
VMPGICGTAVCKNIPRGFECECPEGYRYDPTSKSCQDVDECSENMCTQLCVNYPGGYSCY
CDGKKGFKLAQDQKSCEAVPVCLPLNLDKNYELLYLAEQFVGVVLYLKFRLPDITRFSAE
FDFRTYDSEGVILYAESSDHSAWFLIALRDGKIEIQFKNEYTTKITTGGKIINNGLWNMV
SVEELEHSISVKIAKEAVMNINKPGSLFKPTNGFLETKVYFAGLPRKVENALIRPINPRL
DGCIRGWNLMNQGASGVKEIIQEKQNKHCLVTVEKGSYYPGSGVAQFSIDYKTVSNGEAW
QMNVSLNIRPSAGTGVMLALVSDNTVPFALSLVDSTSENFQDILVSVENTVIARLEVLSL
CSSQQFYLEIRVNRNNLELLTELKKSSIYSEDFQGQFAILDKAMQGTLATYLGGLPDVPF
SATPVNAFYNGCMEVNINGVQLDLDEAISKHNDIRAHSCPSVWKNTKNT
Download sequence
Identical sequences ENSVPAP00000005395 ENSVPAP00000005395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]