SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005483 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005483
Domain Number 1 Region: 123-220
Classification Level Classification E-value
Superfamily AMPKBI-like 3.66e-36
Family AMPKBI-like 0.00000461
Further Details:      
 
Domain Number 2 Region: 24-104
Classification Level Classification E-value
Superfamily E set domains 1.84e-27
Family AMPK-beta glycogen binding domain-like 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005483   Gene: ENSVPAG00000005904   Transcript: ENSVPAT00000005904
Sequence length 220
Comment pep:known_by_projection scaffold:vicPac1:scaffold_7383:10023:18772:-1 gene:ENSVPAG00000005904 transcript:ENSVPAT00000005904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDF
VAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSME
SSETSCRDLSSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPE
PNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
Download sequence
Identical sequences ENSMICP00000002263 ENSVPAP00000005483 ENSVPAP00000005483 ENSMICP00000002263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]