SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005570 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005570
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily SRP19 1.31e-39
Family SRP19 0.000000612
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005570   Gene: ENSVPAG00000006001   Transcript: ENSVPAT00000006001
Sequence length 144
Comment pep:novel genescaffold:vicPac1:GeneScaffold_1471:1138555:1143408:1 gene:ENSVPAG00000006001 transcript:ENSVPAT00000006001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNV
FLEKNKMYSREWNRDLQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYVAEMIPKLKTRTQ
KTGGGDQSLQQGEGSKKGKGKKKK
Download sequence
Identical sequences XP_006192616.1.101512 XP_006204029.1.17985 XP_010969794.1.22495 XP_010985814.1.51371 ENSVPAP00000005570 ENSVPAP00000005570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]