SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005792 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005792
Domain Number 1 Region: 370-477
Classification Level Classification E-value
Superfamily Anthrax protective antigen 4.84e-18
Family Anthrax protective antigen 0.011
Further Details:      
 
Domain Number 2 Region: 1829-1909
Classification Level Classification E-value
Superfamily E set domains 5.92e-17
Family E-set domains of sugar-utilizing enzymes 0.016
Further Details:      
 
Domain Number 3 Region: 1913-1995
Classification Level Classification E-value
Superfamily E set domains 9.24e-16
Family Other IPT/TIG domains 0.017
Further Details:      
 
Domain Number 4 Region: 1999-2085
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000344
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.033
Further Details:      
 
Domain Number 5 Region: 1064-1139
Classification Level Classification E-value
Superfamily E set domains 0.000000000000139
Family E-set domains of sugar-utilizing enzymes 0.015
Further Details:      
 
Domain Number 6 Region: 1238-1318
Classification Level Classification E-value
Superfamily E set domains 0.00000000000028
Family E-set domains of sugar-utilizing enzymes 0.022
Further Details:      
 
Domain Number 7 Region: 2090-2177
Classification Level Classification E-value
Superfamily E set domains 0.00000000000035
Family Other IPT/TIG domains 0.054
Further Details:      
 
Domain Number 8 Region: 1155-1234
Classification Level Classification E-value
Superfamily E set domains 0.000000000000537
Family E-set domains of sugar-utilizing enzymes 0.011
Further Details:      
 
Domain Number 9 Region: 3048-3107,3315-3514
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000321
Family Galacturonase 0.069
Further Details:      
 
Domain Number 10 Region: 1657-1744
Classification Level Classification E-value
Superfamily E set domains 0.0000000000084
Family Other IPT/TIG domains 0.054
Further Details:      
 
Domain Number 11 Region: 1747-1824
Classification Level Classification E-value
Superfamily E set domains 0.000000000168
Family E-set domains of sugar-utilizing enzymes 0.019
Further Details:      
 
Domain Number 12 Region: 1331-1396
Classification Level Classification E-value
Superfamily E set domains 0.00000000484
Family E-set domains of sugar-utilizing enzymes 0.021
Further Details:      
 
Domain Number 13 Region: 32-125
Classification Level Classification E-value
Superfamily E set domains 0.00000000917
Family E-set domains of sugar-utilizing enzymes 0.073
Further Details:      
 
Domain Number 14 Region: 274-359
Classification Level Classification E-value
Superfamily E set domains 0.0000000243
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Domain Number 15 Region: 143-241
Classification Level Classification E-value
Superfamily E set domains 0.000000233
Family E-set domains of sugar-utilizing enzymes 0.033
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000005792
Domain Number - Region: 1406-1501
Classification Level Classification E-value
Superfamily Cupredoxins 0.000902
Family Plastocyanin/azurin-like 0.069
Further Details:      
 
Domain Number - Region: 2457-2541,2663-2746
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0799
Family Galacturonase 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005792   Gene: ENSVPAG00000006241   Transcript: ENSVPAT00000006246
Sequence length 4231
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1087:117389:263594:1 gene:ENSVPAG00000006241 transcript:ENSVPAT00000006246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHMWLWGTWSLWGLLLCVAEPHADGSKIIPKITEIIPKYGSINGATRLTIKGEGFAQAS
QFNYGVDNAEVGNSVQLVSSFRSISCDVEKDSSHSTQITCYTRAMPEDSYTVRVSVDGVP
ITENNTCKGHINSRACSFYAKNFRTPTIRSITPLSGIPGTLITIQGRIFTDVYGSNTALS
SNGANFKILKVYTGGMPCELLIPQSDNLYGLKLDRPNGDMGSMICKTTGTYIGKCHHNVS
FILDSDYGRSFPQKMAYFVSSLXXXXXXXXXXXVTTISPSQGSVQGGTTLTISGRFFDQT
DFPVRVLVGGQACDINVTNSICCRTPKPDIRTVYPGGRGLKLEVWNNSRPVHLEEILEYN
EKTPGYLGASWVDSASYVWPTEQDAFVARFSGFLVAPDSDVYRFYIKGDDRYAIYFSQTG
LPEDKMRIAYHSSNANSYFSSPTQRSDDIHLQKGKEYYIEILLQEYRLSAFVDVGLYQYR
NVYTEQQTEDAVNEEQVIKSQSTIVQEVQVITLENWGTTNATNEVQKITVTSPCVGANSC
SLYQYRLIYNMEKTVWLPADASDFILQSALNDLWSIKPDAVQVIRTQNPQSYVYMVTFIS
TRGDFDLLSYEVFERNNVTVDITEQIKGKPSLDTFTLNWDGITSKPLTPQSSEAEFQAAV
EEMVSTKCPPQIANFEEGFLVKYFRDYETDFNLEHINRGQKTAETDAYCGRYSLKNPAVL
FDSADVKPNRLPYGDILLFPYNQLCLAYKGFLTNYIGLKFHYQDTRKITRSTDTQFTYNF
AYGNNWTYTCIDLLDLIQTKYAGTNFSLQRISLQKASESQSFYVDIVYIAQTSTIATLHE
MPKRRLPALANKGIFLKHFQVNQTKISGPNMTNQYVVTMTSYNCSYNIPMMAVSFGQIIT
NETENESVYRGNNWPGESKICIQRIQAASPPLNGSFDIQAYGHILKGLPAAVSAADLQFA
LQSLEEVGQVSVTREGTCAGYSWTIKWRSACGKQNLLQINDSNIFGEKANMTVTKIKEGG
LLRRHILGDLLRTPSKQPQVEVYINEIPAKCSGDCGFTWDPTTTPQVSAISPSQGSYEES
TILTISGSGFSPSSAVSVSVGPVGCSLLSVNDNEIKCQVLNGSAGHFPVAVSVADVGLAR
SVEEKEEFHFIYHSQISHILPASGSLAGGTLLTLSGFGFNENSKVLVGNETCNIIEGDLN
KITCRTPKRTEGTVDISVITSGFEATAKNAYSYNCLQTPVITDFSPKVRTILGEVNLTIK
GYNFGNELTQNMEVYVGGKACQVLHWNFTDVRCLLPKLSPGKHDICVEVRNWGFASTRDK
LNASIRYILEVTNMFPQKGSLYGGTEITIMGLGFSTIPAENTVLLGSFPCNVTSSSENVI
KCILHSTGNVFRITNGGEDSVHGLRYAWSPSVLNVSVGDIVTWHWQVHPYLRGIGYRVFS
VSSPGSVIYDGKGFTNGREKSATGSFSYQFTSPGIHYYSSGYVDEAQSIFLQGVINALPA
ETRHVPLHLFVGGSEATYAPGGPVNLHLGSSVAGCLATEPLCGLNNTEVKNSNRLLFELS
SCFSPSISNISPSXXXXXXXXXXXXXXXXXXXXANKVTIGSYPCVVEESSNNSIVCHIDP
QNSMDVGFREIVRLTVYNLGTAINTLSNEFDRRFVLLPNIDMVLPNAGSTTGMTKVTVKG
SGFAGPSAGVRVLMGHSPCSVLSVNYTAIECETSPAPQQLVKVNLLIHGVPAQCQGNCSF
SYLESITPSITRVSPNSITGSAQVLIEGEGFGALLEDISVFIGNQQFRAIDVNENNITVL
VTPLPAGLYSLSVVVGTKGLALGNLTVRSPAVASVTPASGSTGGGTTLVITGNGFYPGNT
TVTVGDEPCPIISVSSSEVCCRTPAGKAGTVSVKISVNAVAYPPLSFTYALEDTPLLRGI
VPSTGPPGTEIQITGSNFGTDILEISVAIDNIQCNVTMVNDTVLQCITGDHAGGTFAVMM
HHKTKGSAVSTVVFEYPLSIQNIHPSQGSFGGGQTMTVTGTGFNPQNSVILVCGSKCAVD
RLASNSTTLLCEIPPNDGGGPEQRCEVSVVNGKNLSRSTAPFTYTMSLTPLVTKIAPQRG
STAGGTRLTVLGAGFSENIQDVLVTIAEARCDVEYSNKTYLICMTNAHSPSGWASVRVNI
RGIGVAKLDNADFLYVDSWSSSFSWGGKSPPEEGSLAVITKGQTILLDQNTPILKMLLIQ
GGTLIFDEADIELQAENILITDGGVLQIGTEASPFQHKAIITLHGHLRSPELPVYGAKTL
AVREGILDLHGLPVPVIWTRLAHTAKAGERTLILQEAVTWKPGDKVVIASTGHRHSQQEN
EKRTIASVSADGINVTLTESLSYTHLGITVTLPDGTLFEARAEIGILTRNILIRGSDNVE
WNNKIPACPDGFDTGEFATQTCLQGKFGEEIGSDQFGGCIMFHAPVPGVNLVTGRLEHVE
ICHAGQAFRLGRYPIHWHLLGDLQFKSYVRGCAIHQTYNRAVTIHNTHHLLVERNIIYDI
RGGAFFIEDGIEHGNILQYNAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXAEWVNGGALQFHNFVMVNNEAGIETKRILAPYVGGWGETNGAV
IKNAKIVGHLDELGTGSAFCTRKGLVLPFSEGLTVSSVHFMNFDRPRCVALGVTSITGVC
NDRCGGWSAKFVDIQYSHTPNKAGFRWEHEVVLIDVDGSLTXXXXXXVIHSSLLDPSHCT
QEAEWSIGFTGSVCDASVSFHRLAFNKPSPVSLLEKDVVLSDSFGTSIVPFQKKRLTHMS
GWMALIPNAKHINWYFKDVDHVTNISYTSTFYGFKEEDYVIISHNFTQNPDMFNINDVRN
GSSTPLNWNTNKNGDWHLEANTSTLYYLVSGRNDLHQSQPISGTVDPDVKDVVINFQAYC
CVLQDCFPVPSPSRKPTPRKRPATYYLWSNDSFWQSSQENNYTIPHPGANVVIPEGTWIV
ADTDIPPMERLIIWGVLELEDKHNVGATGSSYGKVVLNATYISLQGGRLIGGWEDNPFKG
ELQIVLRGSHSTPEWALPEGPNQGSKVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXEGEEIVITTTSYDFHQTETRSIVKILHDHKLLILNDTLSYTHLAQRYHVPAT
GQSYTLAADVGILSRNIKILGEDYPGWFKESFGARVLVSSFTENEMTFKGNARISNVEFY
HSGQEGFRDSTDPRYAVTFLNLGQIQEHGSSYIRGCAFHNGFSPAIGVFGTDGLDIDDNI
IHFTVGEGIRIWGDANRVRGNLVTLSVWPGTYQNRKDLSSTLWHAAIEINRGTNTVLQNN
VVAGFGRAGYRIDGEPCWGQSNFLEKWFDNEAHGGLYGIYMNQDGLPQCSLIQGFTIWAC
WDYGIYFQTTESVRIYNVTLVDNGMAISSMIYMPPAVSHKISSKTVQIKLISDVLTNDDP
NIELSAAHRSSRPPSGGRSGICWPTFASAHNMAPQKPHAGIMSYNAISGLLDVSGKCSTF
VGFKNVCSGETNVIFITNPLNEDLQHPIHVKNIQLVDTTEQSKIFIHRPDVSKVNPSDCV
DMVCDAKRKSLLRDMDGSFLGNSGSVIPEAEYEWNGNSQFGIGDYRIPKVMLSFPNGSRI
PITEKAPYKGIIRDSTCKYIPEWQSYRCFGMEHAMMVIESLDSDTETRRLSPVAIVGNGY
VDLINGPQDHGWCAGYTCRRRLSLFHSIVALGKSYEVYFTGTSPXXXXXXXXXXXXXXAV
LVGIFFSTLQRLDVYVNNALVXXXXXXXXXXXXXXXXXXXXXXXQFLPNLNSTVLGENYF
DRTYQMLYLLVKGTIPVEIHTTTVIFVSFQLPAVTEDDFYSSHNLVRNLALFLKIPSDKI
RVSKIIRGENLRRKRALGLTVELEIGDPPPQFITNDTAGQMQLYELQKIADSLGQAVILG
KTSSVLGFNISSMFITNPVPSPSDSGWIKVTAQPVERLAFPVHHVAFVSSLSVITQPATT
QPGQPFSQQPSVKAVDSDGNCVSVEITSLTLKAVLKDSNNNQISGLSGNTTVPFSGCWAN
YTDLTLLRTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXSN
Download sequence
Identical sequences ENSVPAP00000005792 ENSVPAP00000005792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]