SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005819 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005819
Domain Number 1 Region: 306-487
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.72e-48
Family Transglutaminase core 0.0000288
Further Details:      
 
Domain Number 2 Region: 499-609
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.93e-18
Family Transglutaminase, two C-terminal domains 0.0052
Further Details:      
 
Domain Number 3 Region: 660-709
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.000000000419
Family Transglutaminase, two C-terminal domains 0.0042
Further Details:      
 
Domain Number 4 Region: 173-213
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00000101
Family Transglutaminase core 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005819   Gene: ENSVPAG00000006273   Transcript: ENSVPAT00000006273
Sequence length 714
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2874:1426937:1457116:-1 gene:ENSVPAG00000006273 transcript:ENSVPAT00000006273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQGEPSQLSTGLTGLVAPPSLHVFIRRSRMXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDAVFIENE
TQRREYVLNQNGLIYLGTADCIQAESWDFGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXLRGLGIPARVVTTFTSAQGTGGSLLVDEYYNEEGLQVDEGERGRIWVFQTSTEC
WMARPALPQGYDGWQILYPSAPQGGRALGACDLVPVRAVKEGTLGLTPAVSDLFASINAS
CVVWKRHEDGTQQLTNSNTTYLGNNISTKGVYTDRCDDITQNYKYPEGSPQEKEVLKRVQ
ERLKDRKDSGIQPPSLETDDPLYLFLEVPSSLPLGGDVKLSVKLFNPTDHEKEVQLAIAL
AVYYNGVLAAKFWRELLLTLANSVETISTTLSSNLEQTLPENIFLRLTAMATHSESGLTS
FAQEDIALCRPHLVIEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XLSSVQPGDTLHTQFEFTPMHVGLQRLTVEMDCNLFQNLTNFRRVTVVPSEPPA
Download sequence
Identical sequences ENSVPAP00000005819 ENSVPAP00000005819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]