SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005820 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005820
Domain Number 1 Region: 3-145
Classification Level Classification E-value
Superfamily E set domains 5.25e-42
Family Transglutaminase N-terminal domain 0.00015
Further Details:      
 
Domain Number 2 Region: 302-369
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.92e-24
Family Transglutaminase core 0.00021
Further Details:      
 
Domain Number 3 Region: 668-716
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000000147
Family Transglutaminase, two C-terminal domains 0.0041
Further Details:      
 
Domain Number 4 Region: 184-229
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.000000687
Family Transglutaminase core 0.0016
Further Details:      
 
Domain Number 5 Region: 572-617
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00000445
Family Transglutaminase, two C-terminal domains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005820   Gene: ENSVPAG00000006275   Transcript: ENSVPAT00000006274
Sequence length 719
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2874:1461799:1522935:-1 gene:ENSVPAG00000006275 transcript:ENSVPAT00000006274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGLEVALIDLQSSWNNVRHHTEEISSNRLLLRRGQSFNITLYFRNRAFQPGLDDIIFV
AETGPLPDLAKGTRAVFSLAGHSGPSPWIASLETLGATSLEVSLCAPPTAAVGRYLLKVH
IKSLQGPVTAYQLGEFILLFNPWCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXFEENIIDICLELLDKSLNFQIDPATDCALRGSPVYVSRVVCAMXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XFDSGHDTDGNLIIEEYYDSTGRILENKKKDTVWNFHVWNECWMARKDLPPGYGGWQVLD
ATPQETSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSHPCKIPYSQYSQYLSTDKLIRISALG
EEKSSPEKILVNKIITLAYPGIMINXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXQQRVIGVLKPQHRASLTLETVPFKSGQRQIQANLRSNKFKDIKGYRNVYVDFGL
Download sequence
Identical sequences ENSVPAP00000005820 ENSVPAP00000005820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]