SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005822 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005822
Domain Number 1 Region: 148-370
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.09e-86
Family Transglutaminase core 0.000000246
Further Details:      
 
Domain Number 2 Region: 66-146
Classification Level Classification E-value
Superfamily E set domains 6.3e-18
Family Transglutaminase N-terminal domain 0.0013
Further Details:      
 
Domain Number 3 Region: 563-606
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.000000238
Family Transglutaminase, two C-terminal domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005822   Gene: ENSVPAG00000006276   Transcript: ENSVPAT00000006276
Sequence length 613
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2874:1540560:1590910:-1 gene:ENSVPAG00000006276 transcript:ENSVPAT00000006276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXPEPTELLGTRATFLLTSARQGNVWSASDFTIDANSLSVSLFTPASAVIGPYTLKI
KISQGQGHSLTHLLGTFILLFNPWSAEDDVYLPSEILLQEYIMMDYGFVYKGHERFITPW
PWNYGQFEEGIIDICFEILNKSLSFLENPSKACSQRNDVVYVCRVVSAMINSNDDSGVLQ
GNWGEDYSRGLSPLEWSGSVAILRQWSAGGGQPVRYGQCWVFAAVMCTVMRCLGVPTRVV
SNFRSAHNADANLTIDTYYDQNAVMLPTQKRDKIWNFHVWNECWMIRKDLPPGYNGWQVL
DPTPQETSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXIQRSLSLPYNNYKNKLTDEKLIRVSGIAKVAETGRSMLVL
KDISLEPPHLAIE
Download sequence
Identical sequences ENSVPAP00000005822 ENSVPAP00000005822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]