SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005951 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005951
Domain Number 1 Region: 258-301
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 7.94e-16
Family Transcriptional factor domain 0.00036
Further Details:      
 
Domain Number 2 Region: 1-44
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000000000209
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00025
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000005951
Domain Number - Region: 124-159
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 0.00837
Family Elongation factor TFIIS domain 2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005951   Gene: ENSVPAG00000006414   Transcript: ENSVPAT00000006414
Sequence length 303
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3035:228987:268850:-1 gene:ENSVPAG00000006414 transcript:ENSVPAT00000006414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIGVAVNGVRKHCSDKEVVSLAKVLIRNWKRLLESPAPPKGEKGEGRVKAKKKEKGLDCS
SWKPETSLSPPRKKHVEEPKDRRDSVDSKSSATSSPKRPSMERSNSLKSKAEAPRTPSSP
SSPTFAPSICLLAPCYLTGDSVRDKCVEMLSAALKADXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEMASDELRELRN
AMTQEAIREHQMAKTGGTTTDLFQCSKCKKKNCTYNQEQTRSADEPMTTFVLCNECGNRW
KFC
Download sequence
Identical sequences ENSVPAP00000005951 ENSVPAP00000005951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]