SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006085 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006085
Domain Number 1 Region: 949-1113
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.34e-22
Family Laminin G-like module 0.0048
Further Details:      
 
Domain Number 2 Region: 148-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000839
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 3 Region: 135-266
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000628
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 1140-1181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000668
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 5 Region: 262-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000373
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 6 Region: 1137-1251
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000769
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 7 Region: 893-944
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000163
Family EGF-type module 0.021
Further Details:      
 
Domain Number 8 Region: 70-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000429
Family Laminin-type module 0.073
Further Details:      
 
Domain Number 9 Region: 302-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000006085
Domain Number - Region: 1261-1292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00801
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 27-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0106
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006085   Gene: ENSVPAG00000006552   Transcript: ENSVPAT00000006552
Sequence length 1292
Comment pep:novel genescaffold:vicPac1:GeneScaffold_229:147013:273196:1 gene:ENSVPAG00000006552 transcript:ENSVPAT00000006552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGTTHCLLILYLGLALLTSIRNSFCNENDTECLSHSCQNNSTCKDASEDHSCPCADTA
LHLGKGCDEEPDPCVSSPCPGNATCVSAPGERGFLCRCPPGSSGAACDTADEACGAGPCQ
HGGVCRLGPAQPACVCPPGFAGSFCELDRDECASSPCRNGAVCRDGANGYACFCVPGYQG
RHCDVEVDECASHPCGNGATCLNEIGRYACLCPRPYSXXXXXXXXXXCWSQPCLHGATCQ
DAVGAYFCDCAPGFLGERCEINTDECASEPCLHGGLCVDGADSYSCNCTGSGFTGTHCET
PVPPCWSKPCHNNATCEDGADGYICHCWPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXFFFSLAQSSVFACFCPPGLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPCYNGG
VCYALWDDFSCACPANTAGKTCQDVRWCELGPCPPGARCQQVPGGFECTANAVFNGQSSE
IVFRSNGNITRELTNITFGFRTRVANAEILHAEKEPEFLNVSIRDSRLLFQLQSGNSFYR
LSLTSSQSVDDGVWHQVTLSMTDPLAQASRWQMEMDHQTPPVTSVVATGSLSFLKEDVDI
CVGGRADGPVQGLQGCLSTIVVGGVHLSYFENVRGFLNKPQEEQFLKVSVNTVATGCLQL
NACKSNPCLHGGHCEDTYSSHHCACPEGWSGPRCERDIDECLSDPCIHGNCSDRVAAYHC
RCEPGYTGVNCEAGVDHCQSHQCASGATCISHAKGYSCRCPGNFTGKFCRHTGLPPAVCG
NERTNFTCYSGGNCTEAQGEPRCVCAPGFAGQ
Download sequence
Identical sequences ENSVPAP00000006085 ENSVPAP00000006085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]