SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006331 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006331
Domain Number 1 Region: 496-752
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.57e-88
Family PDEase 0.0000019
Further Details:      
 
Domain Number 2 Region: 56-250
Classification Level Classification E-value
Superfamily GAF domain-like 2.13e-32
Family GAF domain 0.00036
Further Details:      
 
Domain Number 3 Region: 237-294,331-458
Classification Level Classification E-value
Superfamily GAF domain-like 8.63e-29
Family GAF domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006331   Gene: ENSVPAG00000006814   Transcript: ENSVPAT00000006814
Sequence length 858
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1385:41457:106234:-1 gene:ENSVPAG00000006814 transcript:ENSVPAT00000006814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEVTAEEVEKFLDSNVGFAREYYNLRYRAKVVSDLLGARETAVDFSHYHALNSVEESEI
IFDLLRDFQENLQAEKCIFNVMKKLCFLLHADRMSLFMYRARNGIAELATRLFNVHKDAV
LEDCLVAPDSEIVFPLDMGVVGHVAVSKKVINVPNTEEDEHFCDFVDTLTEYQTKNILAS
PIMNGKDVVAIIMAVNKVDGPCFTERDEEILLKYLNFANLIMKVFHLSYLHNCETRRGQI
LLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLDMTKQKEFFDVWPVLMGEAP
PYSGPRTPDGRXXXXXXXXXXXXXXXXXXXXXXNPPPDHWALVSGLPTYVAQNGLICNIM
NAPAEDFFAFQKEPLDESGWMIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEMDETLM
ESLAQFLGWSVLNPDTYESMNRLENRKDIFQDMVKYHVKCDNEEIQQILKTREVYGKEPW
ECEEEELAEILQGELPDAERYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQE
TLVRFMYSLSKGYRRITYHNWRHGFNVGQTMFSLLVTGKLKRYFTDLEALAMVTAAFCHD
IDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKTLLRDENLNIFQNLNRRQHEHAIH
MMDIAIIATDLALYFKKRTMFQKIVDQSKTYETQQEWTQYMMLEQTRKEIVMAMMMTACD
LSAITKPWEVQSKVALLVAAEFWEQGDLERSVLQQNPIXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYEAKIKELQGEKEKDQAPKQATVGN
QPGGKPSSGAASKSCCIQ
Download sequence
Identical sequences ENSVPAP00000006331 ENSVPAP00000006331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]