SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006350 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006350
Domain Number 1 Region: 3-149
Classification Level Classification E-value
Superfamily E set domains 1.68e-56
Family RhoGDI-like 0.0000000891
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006350   Gene: ENSVPAG00000006834   Transcript: ENSVPAT00000006834
Sequence length 149
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2166:39905:87174:-1 gene:ENSVPAG00000006834 transcript:ENSVPAT00000006834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSADERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSR
ELNFSSAEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPAS
VLTGNVIIETKFFDDDLLVSTSRVRLFYV
Download sequence
Identical sequences ENSVPAP00000006350 ENSVPAP00000006350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]