SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006360 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006360
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily E set domains 1.92e-34
Family Arrestin/Vps26-like 0.00000229
Further Details:      
 
Domain Number 2 Region: 223-348
Classification Level Classification E-value
Superfamily E set domains 1.59e-19
Family Arrestin/Vps26-like 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006360   Gene: ENSVPAG00000006845   Transcript: ENSVPAT00000006844
Sequence length 354
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_399:198822:219837:1 gene:ENSVPAG00000006845 transcript:ENSVPAT00000006844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVVLVDPELVKGKRVYVSLTCAFRYGQEDIDVIGLTFRRDLYFSQVQVFPPVGASGASTK
LQESLIKKLGGHTYPFLLTFPDYLPCSVMLQPAPQDVGKXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKVPPNSTLTTTLTLVP
LLANRERRGIALDGIKHEDTNLASSTILKEGIDKTVMGILVSYQIKVKLMVSGVTARQRX
XXXXXXXXXXXXXXXXXXXXFSFQDENFVFEEFARQNLKDAGEYKEEKKDQMDE
Download sequence
Identical sequences ENSVPAP00000006360 ENSVPAP00000006360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]