SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Vicugna pacos 76_1 > ENSVPAP00000006360

Domain assignment for ENSVPAP00000006360 from Vicugna pacos 76_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSVPAP00000006360
Domain Number 1	Region: 1-100
Classification Level	Classification	E-value
Superfamily	E set domains	1.92e-34
Family	Arrestin/Vps26-like	0.00000229
Further Details:

Domain Number 2	Region: 223-348
Classification Level	Classification	E-value
Superfamily	E set domains	1.59e-19
Family	Arrestin/Vps26-like	0.0000111
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSVPAP00000006360 Gene: ENSVPAG00000006845 Transcript: ENSVPAT00000006844
Sequence length	354
Comment	pep:known_by_projection genescaffold:vicPac1:GeneScaffold_399:198822:219837:1 gene:ENSVPAG00000006845 transcript:ENSVPAT00000006844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	GVVLVDPELVKGKRVYVSLTCAFRYGQEDIDVIGLTFRRDLYFSQVQVFPPVGASGASTK LQESLIKKLGGHTYPFLLTFPDYLPCSVMLQPAPQDVGKXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKVPPNSTLTTTLTLVP LLANRERRGIALDGIKHEDTNLASSTILKEGIDKTVMGILVSYQIKVKLMVSGVTARQRX XXXXXXXXXXXXXXXXXXXXFSFQDENFVFEEFARQNLKDAGEYKEEKKDQMDE
Download sequence
Identical sequences	ENSVPAP00000006360 ENSVPAP00000006360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]