SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006508 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006508
Domain Number 1 Region: 3868-3962
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 0.0000000000471
Family Hect, E3 ligase catalytic domain 0.009
Further Details:      
 
Domain Number 2 Region: 3626-3711
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 0.00000000034
Family Hect, E3 ligase catalytic domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006508   Gene: ENSVPAG00000006999   Transcript: ENSVPAT00000006999
Sequence length 3969
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_432:304656:438700:-1 gene:ENSVPAG00000006999 transcript:ENSVPAT00000006999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPANHLPVGSTMSTVHLSSDGTYFYWIWSPASLNEKTPKGHSVFMDIFELVLENGVFVAN
PLQERTILMRKEGESAKSINEMLLSRLSRYRASPSATLAALTGSTISNTLKEDQAANTSC
GLPLKMLRKTPIYTCGTYLVMLVPPPGGSGSSATRSLFGGTSGLSSLKSACYDTVNNMLW
TCSNDYIDQWCNPGNQAFHYVCQRLGVSHIITEPKDEAITTNEVINQLLHHVGAMCIHQL
NLLATNPNLPITSVLGKQHPIEAHHLSSICDIMEKAMVNGDTCIIRCILVVFQVVFKFFF
SPQTERNRDIIRRSGLLLWQLLMAPKDQICPEIQKEVCLAISSGLNILYPGETEINNLLK
LVLTEGERNSGLSQLRDVILTNLAEQLQNNRFGSEEDDHYRLNDELLHYILKIVVRESCI
LITKCQTVSKDDFQKLLSTVPAASSCLRYLMAVQNHLLSNTILIKPDENDDSDNSLQGET
LKVQELKVSILALATQILTGCDEVLEMLQQVTTALINSDIADREQRLKGLEQVTKATMLG
HLLPVLLTSLMHPNLQTLTMADALMPQLVQLVLYTSQXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXMLEEKEEPGFLTGLKIPAPWAAGKTVETVHPVRDNYKFKETVHIPGARC
LYLRFDSRCSSQYDYDKLVIYAGPNTNSRKVAEYGGNTLGYGSRSVLGTGWPKDLVKVEG
DTVTFSFEMRSGREHNTPDKAMWGFACTVRAQESEDVSGGLPFLVDLPLGLSLLACSMLR
FLYTGPEITKEEGTCQELLRSKLLQRCQWQVEANGVISPALTPSPSPLPLTIEEDREFTY
PSDVLVPPVGNYFDLPRIRLPPGIMIKLREISGRARPQFRPSIKEVIQPDVMEEMVVSCV
IKHLNLVDALQSLINFQYQEEHAEEYDLLCKIMGETFKKLNAMERQLQSVAELEQKWQSE
VDDAMQGKLENNMPFFYDYHFNENKMKELELLCSMKEVSFDGNDLENMVLSLREKFLQEV
NSLIQKPSHPLAKTKTLVKSLMNRAELLLHVTIAAQSGLTRSISGTPAETPACKSASETK
VISHAVRQPVFLRSMSAPSDLEMIGNEDLEFTRANQRRRHVTSHRSSSFTLLQSLAIEDS
RDKPTYSVLLGQLFAFIGTNPDQAVSSSSFLLAAQTRWRRGNTRKQALVHMRELLTAAVR
VGGVTHLVGPVTMVLQGGPRIEELTCGGMVEQVQEAFGETMTSVVSLCARYPIACANSIG
LLCTIPYTRSEEKCLVRSGLVQLMDRLCSLSSQTESSSSEKQTKKQKVATMAWAAFQVLA
NRCVEWEKEEGGSTEAVHSGLARQVSSLLTNHLARATECCGNQAAGNDALQDVLSLLNDL
SRSHIGKAILSQPACVSKLLSLLLDQRPSPKLVLIILQLCRAALPLMSVEDCGNVELPPW
SYSVPSLNSEQEDPSDPASKIASLLLAKLADYVVPGCQTVLSPTASEPDTTLTKTSPKSS
LKGDKDPGEESEAVDGKLSIFIHKREDQSSHEVLQPLLSSSEGRPFRLGTGANMEKVVKM
DRDMTKGGCCEVITEEAAAALRKATKWAQSGLIVSVGPPVESVNPETVSGLSTGDKKKTA
QTSICRERNSELARTDPVRPFISGHVANSMAAEVIALLHSLLMAPESNAAQIWTTTAEKV
LSRALMYIPQLGKYAESILENGSSSGRKLAKLQRIARQAVAALCALGGFKETIKIGSEVQ
VLGRGISGSIGVVASINEQEGIATVRFPPIDCRKTSQASDTLTIPLSRLCVPRSEALPLH
KLSITEKVVQAVQSMLLPQEGSLSIHTSLPATGDGSAPVMAVVRLLAIRTRACLVMAQLL
EDSLFCEEFIQQCPAAVEVLNLVAQECSAGERLRMLYRDCARPPPPPLQADRRQPKEITW
SPSRVFPPVRACMFSSHLTSVTFLADPSAGGGLPRGTFIYATSPLPVQAPSFYWEIEVVS
YGDTDDDTGPIVSFGFATEAEKRDGAWTNPVGTCLFHXXXXXXXXXXXXXXXXXXXXXXX
XXXXXDVAGIGWERTEGTPPPPGQPAKGRVYFTYCGQRLSPYLEDVSGGMWPVVHIQKKN
TKTRANFGSRPFAYAEGQAHRNAADLCTDLAEEISANFELPFAMASDSDNDAGTSIASDP
GTHGPPCRIAAVATAQQQYDSDTSCHYKVELSYENFITSGPDPHPPPIADDESDDDDDDD
IPQEDHYALLVKAWETKVFPTIRRRFRNEAERKSGLDQIKGALQLGMVDIARQTVEFLYE
ENGGIPRDLYLPTIEDIKDEANKFTIDKVRKGLTVVTRSPDSNNVASSTVGTALPKFAIR
GMLKTFGLHGVVLDVDSVNELVQVETYLRSEGVLVRYWYPIDMLERPPAGYRRTATNGLV
TLDNTNLQIHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXGTISSSSILLAQSLQHCVHAQNCSATDLFYQGNSQTVREWLNVAITRT
LHQGEESLLELTRQICSFLQTAPEQFPSEEFPISESKVNMDVNFPGAAFVVVSCKESQSG
FRKDSSLYKAPWARVLVYGLGHKVKRNGQLNLIEAVCYPRDASPANTGLTPPPTTNQYPS
VILSTDKVHIKLGVSPPPGAVLVLHSLPLEFPLAVAFAEQLLSWKSEDGEGRAEDEPDTI
PTSVLLQVVELLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKLVPGAREVLTEIFKSCAHSE
QTLSLTPAKPIKVSDIYLSKEQINSQTPGNLLHLFFTNVRPPKKVLEDQLTQILRKYGVP
KPKFDKSKYSKAGKEQHPGKVVSTKRPITKPPAKDKAVLNSVXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXGSFRHFLWQVCKELQSSSLSLLLLCPNSAVNKNKG
KYILTPSPITYCKEQLLHLLGQLLGIAIQADCPLPLNLLPSFRKTLVGEPXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXAQPNQGGVEETGQHFFWGAMEIFSQEKAVNLIKFPDTRERFLFPGP
KEGGPDKIKLPPVPRKMPPPGGQTGSPDSRYIRVETCMFMIKLPQYSSLEIMLEKLRCAI
HYREDPLSG
Download sequence
Identical sequences ENSVPAP00000006508 ENSVPAP00000006508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]