SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006544 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006544
Domain Number 1 Region: 15-291
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.04e-70
Family Histamine methyltransferase 0.000000000552
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006544   Gene: ENSVPAG00000007035   Transcript: ENSVPAT00000007035
Sequence length 292
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1820:1140483:1178509:1 gene:ENSVPAG00000007035 transcript:ENSVPAT00000007035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSMRSLFSDHSRYVECFRRFLSNSTEHQCMQEFMDKKLPGIIARIGDTKSEIKILSIG
GGSGEIDLQILSEAQAQHPGVRINNEVVEPSAEQITKYKELVAKTSNLENIKFTWHKETS
SEYQNRMMEKKEIQKYDFIHMIQMLYYVEDIPATLKFFHGLLATSAKILIVLVSGTSGWD
KLWKKYGSRLPRDDLCQYVTSSHVTQMLDKLGIKYECYDLLSTMDVSDCFIDGSENGDLL
WDFLTETRHFNKTAPPDLKAEITKDLQEPEFSIKKEGKVLFNNNLSFIVAEA
Download sequence
Identical sequences ENSVPAP00000006544 ENSVPAP00000006544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]