SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006785 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006785
Domain Number 1 Region: 95-179
Classification Level Classification E-value
Superfamily E set domains 0.000000000981
Family Filamin repeat (rod domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006785   Gene: ENSVPAG00000007296   Transcript: ENSVPAT00000007296
Sequence length 543
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1588:11180:23022:-1 gene:ENSVPAG00000007296 transcript:ENSVPAT00000007296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMRMANHKSLLVLLLILASWITFTVFRNSTELWTALKLPISLPHWNFFMKSCPEAPLNP
VVSPRKTELRIKKIMEKLDQLIPNRPFTHVTSTTSAKQSRATILNPQDTYCRGDQLDVLL
EVKDHLGRRKQYGGDFLRARMFSPALKAGASGKVTDFNNGTYLVSFTLFWVGKVSLSLLL
IHPSEGVSALWRARKQGYDRVIFTGQFANGTSQVNSDCALFLNSSTELCEYLDTRDQEAF
YCVKPQRVPCAALTHMRSKNKNXXXXXXXXXXXXXXSNVGVEIMEKFDAITVSNCNKKTA
PVQKKCKFGMTSTVPSGHVWKNTWNPISCSLAPIEMKECLKGKFVYLLGDSTIRQWMEYF
KSSINTLKSVDLHETGKFQHQFGVDLDKNIKIQWQKHGYPLVGSLNFSVKEIEYLARVID
RIGGEKNTIIVISLGQHFRPFPIDVFIQRALNVHDAVQRLLLRSPDTMVIIKAENIREMH
NDAERFSDFHGYIQHLAIKDIFQDLNVGIIDAWDITIAYGTNDVHPPQSVVKNQINIMLN
FIC
Download sequence
Identical sequences ENSVPAP00000006785 ENSVPAP00000006785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]