SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006786 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006786
Domain Number 1 Region: 105-190
Classification Level Classification E-value
Superfamily E set domains 0.000000000911
Family Filamin repeat (rod domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000006786
Domain Number - Region: 357-395,427-538
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.0732
Family Rhamnogalacturonan acetylesterase 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006786   Gene: ENSVPAG00000007297   Transcript: ENSVPAT00000007297
Sequence length 558
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1588:55715:69369:1 gene:ENSVPAG00000007297 transcript:ENSVPAT00000007297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPPVSLRTLALFPNARARRLLLMLTSVLVFWVIYFSAKDHTKFIFSLRNPLYLNHWNIF
RKSFPEALLDLEASPTETELRIKGIMEKLDQLMPPRPFTNITTTTSAKHSRATILNPQDT
YCRGDQLDVLLEVKDHLGRRKQYGGDFLRARMFSPALKAGASGKVTDFNNGTYLVSFTLF
WEGKVSLSLLLIHPSERVSALWRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNMGVEIMKNFNP
IKVLPCNSKSENIETKCQLGMKSPFPSGYTVERRWITVFCKQMELNERKNTNDCLKKKLI
YLMGDSTLRQWIYYLQNAVKTLKVFDHHGVGVFKTHVLLDAERHTLIQWKKHSHPFVTQQ
LFSVKDENYIPREIDQIAGDDGTVIVITLGQHFRPFPIKIFIRRAINIQKAIERLFLRSP
KTKVILKTENTREMYLNAELFSDFHGHIQNLIMRGIFEGLNVGVIDAWDMTIAYDTRNVH
PPDYVIGNQINMFLNYIC
Download sequence
Identical sequences ENSVPAP00000006786 ENSVPAP00000006786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]